SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for orange1.1g043402m|PACid:18131257 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  orange1.1g043402m|PACid:18131257
Domain Number - Region: 53-109
Classification Level Classification E-value
Superfamily PH domain-like 0.0184
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) orange1.1g043402m|PACid:18131257
Sequence length 135
Sequence
FLYRHIHSQHHRLVVPYAIGALYNHPLEGLLLDTLGGALSFLVSRMTTRTAVIFFCFAVI
KIVDDHSGLWLPGNIFHLFFQNNITYHDVHHQLQGLKYNYSQPFFSIWDRLLGTHMPYHL
VKLPEGGFEARLKKD
Download sequence
Identical sequences A0A067DEP7
orange1.1g043402m|PACid:18131257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]