SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for orange1.1g006668m|PACid:18132137 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g006668m|PACid:18132137
Domain Number 1 Region: 298-598
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.98e-81
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 26-235
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-41
Family Legume lectins 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) orange1.1g006668m|PACid:18132137
Sequence length 636
Sequence
MKDMLRLFLFIIVVAINFSISPSSALDFLFNSFGSITNGTDLILINDCWVDSTVIRLTND
SNQFSFGRAYYPTKLKMKRSTATNSSILTSFSTSFVFSILPEIASSPGFGLCFVLTNFTS
PPGALASQYFGLFSNATVVTVAPLLAVEFDTGQNPEFNDPDDNHIGVDLNNIESAKHVPA
GYYSSSRNESFVPVRMRNGQNIHAWIDFDGFSASKTNWIEARRVLAWSLSDTGVAREINT
TNFPTFLPPSSSSSLSAGAVAGIVIGCVMGFLIICASTGYYWYWRKNKLKAQEEDEIEEW
ELEYWPHRFSYEELSKATKGFSNDELLGSGGFGRVYKGTLANNNNNNSTEMAVKCVNHDS
KQGLKEFMAEISSMGRLQHKNLVQMRGWCRKGNELMLVYDYMPNGSLNNWIFGKPKKLLG
WKQRRQILADVAEGLNYLHHGWDQVVVHRDIKSGNILLDSEMRGRLGDFGLAKLYQQGEV
PNTTRVVGTLGYLAPELATVSSPTSASDVYSFGVVILEVACGRRPLDMGKGEEEEEAVLM
DWVRNLYGQGKICEAADARIRQEFEAEEMELVLKLGLACCHPDSTRRPTMREVVAVLVGQ
EVAATPKELLGDLARGAVDADFSGGDDSREDAPLQP
Download sequence
Identical sequences A0A067FTI1
orange1.1g006668m|PACid:18132137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]