SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for orange1.1g007869m|PACid:18108799 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g007869m|PACid:18108799
Domain Number 1 Region: 244-536
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.84e-82
Family Protein kinases, catalytic subunit 0.0000971
Further Details:      
 
Domain Number 2 Region: 10-200
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.15e-55
Family Legume lectins 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) orange1.1g007869m|PACid:18108799
Sequence length 586
Sequence
MPFKNKNSNSSTANGTVFSFSTTFVFSILSEYQSQSGHGIAFVIASTRGLPGARPSQYLG
LFNDTNLGNETNHVFAVELDTIKSHGFLDINDNHVGIDINSLKSESSAPAGYYVEYDGLE
KRTNVTLAPINIPRPRSLNTMSLSRDLSSVLNDAMYVGFSSSTGSVLASHYILGWSFKIN
GQAEELNLSQLPKLPRVGPKKRSKFLTIGLPVICVSVIFAAVSGVVYVIRMKRKFAEELE
DWELDHGPHRFRYKDLYIATKGFREKELLGTGGFGRVYRGTLPKSQIEIAVKKISHESRQ
GMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYDQPKVTLNWI
QRFRVIKGVALGLFYLHQEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQ
TTHVVGTLGYLAPEHTRTGKATTSADVFSFGAFLLEVACGRRPIQRQGPSENLILVDWVF
DFWNRGELLEARDPNLGTEYVAEELELVLKLGLLCSHSDPTARPSMRQVVQILERDVALP
AISALRLSTSGITYLEGFDDFAVSNPPSMGFTRPSSVAESLLSGGR
Download sequence
Identical sequences A0A067EBB1
orange1.1g007869m|PACid:18108799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]