SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for orange1.1g013715m|PACid:18116982 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g013715m|PACid:18116982
Domain Number 1 Region: 294-419
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-31
Family Ran-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) orange1.1g013715m|PACid:18116982
Sequence length 437
Sequence
MGDAESALPPSKKRAAGRELSRDNPGLDDEEDSSELESGTFKKATDEVLATRRIVKVRRN
QTASTPSSNPFAGIRLVPSTEPSATVTPATTEPTKTVSPAATELLESSENKVSVDANNDA
GKEAEKGDGEDNKQSESKIDEPVAVEAASSEPEKGEDESSKQTESKNEPASADAAGKKSS
DDKENGAEKSEVDNGKTAGVDKPENEDEKETSHETTDSSQLSSFGQLSSTQNAFTGLAGT
GFSTSTFAFGSIPKDGSASNSTSASVFGQVNNGNSSLFNTPATSIASKSEGTTFPSMQEV
VVETGEENEKVVFSADSVLFEFLDGSWKERGKGELKVNVSTNATGRARLLMRARGNYRLI
LNASLYPDMKLTNMDKKGITFACINSATEGKSGLSTFALKFRDASIVEEFQTAVAAHKDK
TTAVLKTPENSPKATDD
Download sequence
Identical sequences A0A067ED56
orange1.1g013715m|PACid:18116982 XP_006465564.1.29302 XP_006465565.1.29302 XP_006465566.1.29302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]