SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for orange1.1g013762m|PACid:18114590 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g013762m|PACid:18114590
Domain Number 1 Region: 152-339,376-426
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 5.76e-73
Family Tyrosyl-DNA phosphodiesterase TDP1 0.00000227
Further Details:      
 
Domain Number 2 Region: 1-176
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 6.8e-49
Family Tyrosyl-DNA phosphodiesterase TDP1 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) orange1.1g013762m|PACid:18114590
Sequence length 437
Sequence
MVDIDWLLPACPVLAKIPHVLVIHGESDGTLEHMKRNKPANWILHKPPLPISFGTHHSKA
MLLIYPRGVRIIVHTANLIHVDWNNKSQGLWMQDFPLKDQNNLSEECGFENDLIDYLSTL
KWPEFSANLPAHGNFKINPSFFKKFNFSSAAVRLIASVPGYHTGSSLKKWGHMKLRTVLQ
ECTFEKGFKKSPLVYQFSSLGSLDEKWMAELSSSMSSGFSEDKTPLGIGEPLIVWPTVED
VRCSLEGYAAGNAIPSPQKNVDKDFLKKYWAKWKASHTGRSRAMPHIKTFARYNGQKLAW
FLLTSANLSKAAWGALQKNNSQLMIRSYELGVLILPSAKRHGCGFSCTSNIVPSEIKSGS
TETSQIQKTKLVTLTWHGSSDAGASSEVVYLPVPYELPPQRYSSEDVPWSWDKRYTKKDV
YGQVWPRHFQLYAFQDS
Download sequence
Identical sequences A0A067GAA3
orange1.1g013742m|PACid:18114589 orange1.1g013748m|PACid:18114591 orange1.1g013762m|PACid:18114590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]