SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for orange1.1g014528m|PACid:18114592 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g014528m|PACid:18114592
Domain Number 1 Region: 138-325,362-412
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 5.23e-73
Family Tyrosyl-DNA phosphodiesterase TDP1 0.00000227
Further Details:      
 
Domain Number 2 Region: 21-162
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.56e-43
Family Tyrosyl-DNA phosphodiesterase TDP1 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) orange1.1g014528m|PACid:18114592
Sequence length 423
Sequence
MGILLLLFYQTTWWTLIGCCQRNKPANWILHKPPLPISFGTHHSKAMLLIYPRGVRIIVH
TANLIHVDWNNKSQGLWMQDFPLKDQNNLSEECGFENDLIDYLSTLKWPEFSANLPAHGN
FKINPSFFKKFNFSSAAVRLIASVPGYHTGSSLKKWGHMKLRTVLQECTFEKGFKKSPLV
YQFSSLGSLDEKWMAELSSSMSSGFSEDKTPLGIGEPLIVWPTVEDVRCSLEGYAAGNAI
PSPQKNVDKDFLKKYWAKWKASHTGRSRAMPHIKTFARYNGQKLAWFLLTSANLSKAAWG
ALQKNNSQLMIRSYELGVLILPSAKRHGCGFSCTSNIVPSEIKSGSTETSQIQKTKLVTL
TWHGSSDAGASSEVVYLPVPYELPPQRYSSEDVPWSWDKRYTKKDVYGQVWPRHFQLYAF
QDS
Download sequence
Identical sequences A0A067G7E8
orange1.1g014528m|PACid:18114592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]