SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for orange1.1g015176m|PACid:18096864 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g015176m|PACid:18096864
Domain Number 1 Region: 300-407
Classification Level Classification E-value
Superfamily PH domain-like 0.000000143
Family Pleckstrin-homology domain (PH domain) 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) orange1.1g015176m|PACid:18096864
Sequence length 412
Sequence
MSSCMMKSSSQKLENIDENGPAKWLPLSCAPPETPTESMEFLARSWSLSAMELSTALSTT
HVSLNSLDIDKTPPSSDVEACGASSTVLTESVANEGSAPISPRDSEEMREIFVLHQALHP
EFLSSQPLLKNGLYKSIMRGRTMGRWLKDQKERKKQEIRAHNAQLHAAVSVVGVAAAIAA
ITAATTTSQEMTTVQQKSSCKTSAAVASAAALVASHCIEIAEDMGADHDQILTVVNSAVN
ARTNGDIMTLTAGAATALRGAATLRARLQKGYGMTTISLAEEKGHEGKESNISAALNLVS
KGGELLKRTRKGALHWKQVSFNINSNLQVVAKLKSKHMAGAFTKKKKCIVSAVICDIPRW
PPRESEDDSEQRAYFGIKTADRVIEFECRNKGDKQMWVEGIQHILNCCANLR
Download sequence
Identical sequences A0A067GJJ4
XP_015385107.1.29302 orange1.1g015176m|PACid:18096864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]