SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g020733m|PACid:18121953 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g020733m|PACid:18121953
Domain Number 1 Region: 131-231
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.28e-28
Family B3 DNA binding domain 0.00013
Further Details:      
 
Domain Number 2 Region: 43-100
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000000000000124
Family GCC-box binding domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) orange1.1g020733m|PACid:18121953
Sequence length 322
Sequence
MEEEMLSIISNGETNVIPELSDSISSTPLIPATKRLRHASAVSKFKGVVPQQNGHWGAQI
YANHQRIWLGTFKSEKDAAMAYDSAAIRLRGVDSHRNFPWTKITIEEPNFQSHYSTEAVI
NMIRDGSYSSRQLFQKELTPSDVGKLNRLVIPKKYAVKYFPQISERVEEHAENDKADDVQ
LVFHDKSMKLWKFRYCYWKSSQSFVFTRGWNRFVKENQLKANDTICFYLCELRDIAKGTK
TFGMIDAKKGENSGASAEVSGPYVDMKVDLQLQLGQNKKENKVEEDDNGNEIEATEEVEL
KAPSSTSDSERKLFKLFGVEIF
Download sequence
Identical sequences A0A067F7E2
orange1.1g020733m|PACid:18121953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]