SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for orange1.1g021922m|PACid:18096865 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g021922m|PACid:18096865
Domain Number 1 Region: 193-300
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000756
Family Pleckstrin-homology domain (PH domain) 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) orange1.1g021922m|PACid:18096865
Sequence length 305
Sequence
MREIFVLHQALHPEFLSSQPLLKNGLYKSIMRGRTMGRWLKDQKERKKQEIRAHNAQLHA
AVSVVGVAAAIAAITAATTTSQEMTTVQQKSSCKTSAAVASAAALVASHCIEIAEDMGAD
HDQILTVVNSAVNARTNGDIMTLTAGAATALRGAATLRARLQKGYGMTTISLAEEKGHEG
KESNISAALNLVSKGGELLKRTRKGALHWKQVSFNINSNLQVVAKLKSKHMAGAFTKKKK
CIVSAVICDIPRWPPRESEDDSEQRAYFGIKTADRVIEFECRNKGDKQMWVEGIQHILNC
CANLR
Download sequence
Identical sequences A0A067GMA1
orange1.1g021922m|PACid:18096865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]