SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for orange1.1g022898m|PACid:18117950 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g022898m|PACid:18117950
Domain Number 1 Region: 154-234
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.89e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 2 Region: 255-287
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000144
Family CCCH zinc finger 0.0016
Further Details:      
 
Domain Number 3 Region: 93-125
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000288
Family CCCH zinc finger 0.0027
Further Details:      
 
Domain Number 4 Region: 32-57
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000903
Family CCCH zinc finger 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) orange1.1g022898m|PACid:18117950
Sequence length 290
Sequence
MDTRKRTKPETGINANGVFKKSKHESESGVGSKSKPCTKFFSTAGCPFGESCHFLHYFPG
GYNAVAQMMNLPQAVPAPSRNMAVPPPASNGPTVVKSRMCNRLNSAEGCKFGDKCHFAHG
EWELGKPIAISHDDPRAFGAVPGRMGGRYEPPPAPGPAASFGASATAKISVDASLAGAII
GKGGVNSKQICRQTGAKLSIRDHEADPNLRNIELEGSFEQIKQASAMVRELIVRIGPAHA
KNPATAGSAAHPLSSNFKTKLCGNFAKGSCTFGDRCHFAHGAAELRKTAI
Download sequence
Identical sequences A0A067FU61 V4SVR3
clementine0.9_017532m|PACid:19267206 clementine0.9_017568m|PACid:19267205 clementine0.9_017570m|PACid:19267204 orange1.1g022880m|PACid:18117949 orange1.1g022898m|PACid:18117950 orange1.1g022928m|PACid:18117951 XP_006429867.1.91645 XP_006429869.1.91645 XP_006429870.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]