SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for orange1.1g024795m|PACid:18118492 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g024795m|PACid:18118492
Domain Number 1 Region: 115-231
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000379
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Weak hits

Sequence:  orange1.1g024795m|PACid:18118492
Domain Number - Region: 44-104
Classification Level Classification E-value
Superfamily Multimerization domain of the phosphoprotein from sendai virus 0.017
Family Multimerization domain of the phosphoprotein from sendai virus 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) orange1.1g024795m|PACid:18118492
Sequence length 262
Sequence
MEGNLGKIKVISDHFEVPTPSEDSPQINTPSASQPSTDGSLRSQLHSHSWTRRKLKSAAV
MLNMFSLRGLPWVSSSDGQEKVELTATELESLRSELADLEDREAHLKAQLEHVDEILRSA
RLSGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLS
DVVEVASLPSITRENGEMQYCFYILTRHGLRIECSSISKIQVYSWLSALQTDCKLDYEPS
TPNGSSENNCQICTWVKKTEIR
Download sequence
Identical sequences A0A067GMI9
orange1.1g024795m|PACid:18118492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]