SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for orange1.1g028997m|PACid:18120458 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g028997m|PACid:18120458
Domain Number 1 Region: 69-197
Classification Level Classification E-value
Superfamily PH domain-like 4.61e-18
Family Ran-binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) orange1.1g028997m|PACid:18120458
Sequence length 200
Sequence
MEGSLFDVHRAEPSQQQSMTTEPLDMQRAESSRQHVRNQSSLLQNSNDLNDADGEDEVPQ
PSSPSLKKSEERGIIVVHEVKCKLYVKSSDPADKDTWKDRGTGQLSIKCKEGISKGTKES
KPTILVRNDVGRVLLNALLYPGIKTNLQKNSIVAIFHTSGDDAGGGNNGSAAARTFLIRT
KTEEDRNKLATAIQEYAPAS
Download sequence
Identical sequences orange1.1g028997m|PACid:18120458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]