SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for orange1.1g030783m|PACid:18118500 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g030783m|PACid:18118500
Domain Number 1 Region: 55-149
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000324
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Weak hits

Sequence:  orange1.1g030783m|PACid:18118500
Domain Number - Region: 19-53
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0209
Family Mitotic arrest deficient-like 1, Mad1 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) orange1.1g030783m|PACid:18118500
Sequence length 171
Sequence
MLNMFSLRGLPWVSSSDGQEKVELTATELESLRSELADLEDREAHLKAQLEHVDEILRSA
RLSGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLS
DVVEVASLPSITRENGEMQYCFYILTRHGLRIECSSISKIQVLVILIYLYV
Download sequence
Identical sequences A0A067GAC1
orange1.1g030783m|PACid:18118500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]