SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for orange1.1g038860m|PACid:18108785 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g038860m|PACid:18108785
Domain Number 1 Region: 26-279
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.79e-76
Family Legume lectins 0.0001
Further Details:      
 
Domain Number 2 Region: 318-579
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.24e-74
Family Protein kinases, catalytic subunit 0.0000919
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) orange1.1g038860m|PACid:18108785
Sequence length 652
Sequence
MASFLRIFSALIFLSIPVSSQLDELFFPGFKDLSNNLTLQGIAKIENNGILRLTNDTSRK
MGQAFYSSTLRFKNSLNSNVFSFSTSFAIVIVPEYPRLGGHGLAFTISPSNDLNGLPSQY
LGLLNSTDIGNFSNHLFAVEFDTVQDFEFQDINDNHIGIDINSMKSNASVEAAVYTDNST
KQDLSLKGGKAILVWVDYDSAENILNVTVSPNSSKPKIPILSFRVDLSPIFNEFMYVGFS
ASTGLLASSHNVLGWSFKINGPARALDLSSLPSLPGPKKKHHTGAIVGVSIASVVLAICI
LSLAIIYIIKKIKNAEVIEDWELEVGPQRYSYQELKQATNNFSAKQLLGHGGFGQVYKGT
LHNSKTEVAVKRISNESKQGVREFVSEIATIGRLRHRNLVQLVGWCRRKGDLLLVYDFMA
NGSLDSFLFDEPKAVLNWEQRFKIIKGVASGLLYLHEGYEQVVIHRDVKASNVLLDSELN
GKLGDFGLAKLYEHGTNPATTRVVGTLGYLAPETPRTGKSSASSDVFAFGALLLEVACGR
RPIETRALPEELVLVDWVWGKYGEGRVLEVIDPKLNAEYDQSQVLMGELELPDTLRGPRS
SDGDKAAEGFDDLLNSLASSSFDKTTSCSYFENGVSYPSLSTSPITLVYGRD
Download sequence
Identical sequences A0A067EEP5
orange1.1g038860m|PACid:18108785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]