SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for orange1.1g042831m|PACid:18120693 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g042831m|PACid:18120693
Domain Number 1 Region: 337-625
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-83
Family Protein kinases, catalytic subunit 0.0000686
Further Details:      
 
Domain Number 2 Region: 34-263
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.93e-55
Family Legume lectins 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) orange1.1g042831m|PACid:18120693
Sequence length 645
Sequence
MAICNTCSSNSPLLLSFFTITISFCLTIIPLASALTFNYTSFSPQYDDNITYERAYPDSN
RVIQLPANRETAGRATYNQSMRLWDKATGNLTDFTTHFSFVIDSRNSSYYADGLAFFLAP
QGSKIPTNKGGGSFGLTKDNEPLNSSIPFVAVEFDVYVNSWDPTFSHVGIDINSVKSKKN
VSWWSDVKSGRRNEAWISYNSSTHNLSVAFTGFRNNLVVMQGLDYQVDLRQHLPEFVTFG
FSMATGVDFAIFSIYSWEFNSSLEMDDETTNPVSNPKRRRKNRTALVVGLSLGGGVLVGG
VVLIIWLAGIGRKRKEGDEEDNQGFSEYIDDEFERGAGPKRFPYKELALATNDFNDDQKL
GQGGFGGVYKGFFRETNSYIAVKRVSQGSKQGIKEYASEVKIISRLRHRNLVQLLGWCHE
KKELLLVYEFMPNGSLDSHLFKENSLLTWEFRYKIAQDLASGLLYLQEEWEQCVVHRDIK
SSNIMLDSNFNAKIGDFGLARLVEHAKGSQTTVLAGTMGYMAPECATTGKASKESDVYSF
GIVALEIACGRKPINPKAPQGQVSLLQWVWDLYGNGKLLEAVDPRLCRDFDGQQIERLMI
VGLWCAHPDENLRPSIRQVIHVLNFEAPLPALPPKMPVPTYLSPP
Download sequence
Identical sequences A0A067DRJ3
orange1.1g042831m|PACid:18120693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]