SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for orange1.1g048419m|PACid:18094944 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g048419m|PACid:18094944
Domain Number 1 Region: 310-604
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.2e-78
Family Protein kinases, catalytic subunit 0.0000717
Further Details:      
 
Domain Number 2 Region: 7-262
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-63
Family Legume lectins 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) orange1.1g048419m|PACid:18094944
Sequence length 653
Sequence
MVVVHADTTSFLYNGFLHANLSLEGAAYISTSGILTVTNKSEGLIGHALYPNPLRFKTSN
KSVAIDFRTNFVFSILPKYPDLGGQGLAFIIISTNRPENCLANQFLGLPNITMSSSTKFS
TRMLAVEFDIIQNTELIDINDNHVGIDISSLISSASEPASYYSGNNHRIPILLRSGDPIQ
AWVDYSSQEMLINVSICPLGVPKPYRPLISLPIDLSSVIDEYMYTGFSASTGLITASHNV
HGWSISIGGKAQDLNPMKVPTLEKRSHEVVQRRGFSVGITLAGMAFLILIIAGAIHVLQR
IKYADKMLEDWEIQCGARRFKYAELASVTKGFGEQNLVGSGGFGRVYRGLMPSLGLEVAI
KRIGHNSQQGMKEFVAEIMSMGRLRHRNLVQLHGWCRKQDELLLVYDYVPNGSLDKLLFD
KDHKLRKLLTWDQRYKILIGIAQSLLYLHEECNQRVVHRDVKPSNILLDTYLNAKLGDFG
LAKIYEHGANPQTTHIVGTLGYLAPELTRTGKATTSTDVYSYGILMLEVACGRRSIEPQK
AAAELLLVDWVKELHLEGEITQAIDQTLDYYDLAEAELVLNLGLFCSAPNPVYRPDMRRV
VEFLLGDSSLPPLPPDIHLKDTRNIMGFSDFPNDSDFFNSKLMSSQSNSFTSI
Download sequence
Identical sequences A0A067ERK2
orange1.1g048419m|PACid:18094944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]