SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427727936|ref|YP_007074173.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427727936|ref|YP_007074173.1|
Domain Number - Region: 139-200
Classification Level Classification E-value
Superfamily Subtilisin-like 0.0272
Family Subtilases 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427727936|ref|YP_007074173.1|
Sequence length 301
Comment 1,4-dihydroxy-2-naphthoate phytyltransferase [Nostoc sp. PCC 7524]
Sequence
MTTKQISRSQSKLWMAAIKPPMYSVAIMPIWVGTSVAFAENKIVNVGIFSTFIAAAILIL
AWENISNDVFDSETGIDVNKHHSLVNLTGKKTLVFWLGNLCLIAGLLGILAIATWQQDPT
IIGIILLCCFLGYMYQGPPFRLGYQGLGEVLCFFAFGPLGITAAYYSQTKTWSATSLAAS
VIVGIVTSLILFCSHFHQVKDDIAAGKRSPIVRLGTATGAKVLIWFTGIIYPFTLVFVLL
GFFPLWTLLSWLSLPYAFKLCRHVQQNHNQPEKVSNCKFIAVAVHFWSCLLLGVGFAIAG
I
Download sequence
Identical sequences K9QN34
WP_015137035.1.5551 gi|427727936|ref|YP_007074173.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]