SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427728109|ref|YP_007074346.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427728109|ref|YP_007074346.1|
Domain Number 1 Region: 15-221
Classification Level Classification E-value
Superfamily PhoU-like 9.63e-55
Family PhoU-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427728109|ref|YP_007074346.1|
Sequence length 222
Comment phosphate transport system regulatory protein PhoU [Nostoc sp. PCC 7524]
Sequence
MKAVLYSPNPDSPQLARAIRRLERDVLRMGALVEQSFRLSHQALFARDLTAAEELPRLDK
KIDRFYRQIESDCTAIMTLQAPTAQDLRCLSAFMQLVRDLERIGDYAKDLADIAVKIFPY
PPHTSLPEIAVMSHHAQAMLATSLIALADLDEVGGRSIKHLDDAVDNAYDRLYQTLAQQR
DVPGVVEPIILLALAIRCLERMADHATNIGQRVAYIVTGQRS
Download sequence
Identical sequences K9QNT8
WP_015137207.1.5551 gi|427728109|ref|YP_007074346.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]