SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427728288|ref|YP_007074525.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427728288|ref|YP_007074525.1|
Domain Number 1 Region: 6-107
Classification Level Classification E-value
Superfamily Cell growth inhibitor/plasmid maintenance toxic component 0.000000000000589
Family Kid/PemK 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427728288|ref|YP_007074525.1|
Sequence length 110
Comment growth inhibitor [Nostoc sp. PCC 7524]
Sequence
MAGFVKGDVVIVPFPFSDLTQTKRRPTLVIATFPGDDIMLCQITSQFVKDIYAIQLDNSD
FISGSLKQTSNIRPNRIFTADKQIILYKTGQLKSEKLIEVINKIIEIVQK
Download sequence
Identical sequences K9QNG8
gi|427728288|ref|YP_007074525.1| WP_015137384.1.5551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]