SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427728497|ref|YP_007074734.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427728497|ref|YP_007074734.1|
Domain Number 1 Region: 3-220
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 4.22e-57
Family Spore coat polysaccharide biosynthesis protein SpsA 0.0029
Further Details:      
 
Domain Number 2 Region: 308-636
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.26e-34
Family Filamentous hemagglutinin FhaB, secretion domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427728497|ref|YP_007074734.1|
Sequence length 1778
Comment filamentous hemagglutinin family domain-containing protein [Nostoc sp. PCC 7524]
Sequence
MSPLISIVIVNYNRERYIGEAIASVLQQTWQDLELVVWDDGSTDGSVAIAQKYAQQDRRV
RVIAAPHQGTVKARQGAIAQTQGAYLGWVDSDDILAPTALAQTAAVLHRHPEVGLVYTDY
IDINPDGQVLGYGHRCRIPYSPQRLLVDFMTFQFRLLRRSVYEQVGGVHISASDYAYDYD
LCLRLSEVTQVRRVKQPLYLCRIHNQSISATNRTEQILWSQKAIAQALQRRGLAHQCRID
VELPAGRFILRRKPTLGTTLANIKGVFAQTTVCAGIAGLGMLSLWGMNTEIAQAQQILPA
ADGTNTIVTPNGNRIDITGGTTSSNGLNLFHSFQQFGVSPEQIANFQANPALQNILGRVT
GGNASVINGLIQVTGGSANLFLMNPAGFIFGGNASLNVSGAFTATTANGIKFGNDWFNAV
GNNNYANLVGNPTGFAFTMNQPGAIINAGNLGVGTGQSLSLLGGTVVNTGQLSAPAGQIV
VTSVPGQNWVRLSQPGNILSLELPALTPDSSQPNSWTVAIASLPELLTVGNTNTGLTTNP
DGSVKLTNSNVTIPTTPGTTIVSGNVNVSGETGGTVNVLGTKVGLVDANINASGTNGGGT
VLIGGDYKGGGTVPNATQTYINSNTVINADSLQNGNGGRVIAWADDATQFFGNISARGGA
NSGDGGFVEVSGKNFLTFQGQVDVSAPNGQFGTLLLDPSSLTIIDATFGGTFDATFSGSI
LADTPDIGANTISWGALVSLGSGANINLEATGDITIDNITGVVSGENNLITLDSSNSGSF
TLNSTNGAVRFVDTNDTIATNGGAINISGAGDILLGNIITTGGGYASNITVTSSNGSINT
GNLQTRPSDSPAFSSNEYGNVSLSAFGNISTGNIIASGDGYSPGNITVNSSNGAINLGNL
DTRSIFEDGTITFIFDDSGDVTLSASGNISVGNIIASGDGYSPGNVSVDSSNGNINIGNL
DTSVINQSDATAGTVTLSAAGNIFTGDINSYSDEGFDSGQGGAVEITTSGGSITTGDINS
YVFKNIGGDFTGTGGQVTLTASNNIIVGDIDASAEVTEIDGTAEAIGGNVTLQTTNTAGS
IIRFNSINTSATTDEDSSIQAGNVEVLTNGLVQGTGTGNTINTGEFYLVFDEIEQVPFTT
PLSSGGTVTIQHDGGPGNVPFTVGNSSINGTAGAIYAGSASNNLSSGSFPVLPTGGEASG
TPSNITIRSVNTPPTLTANSPISLNAQPGVPFNFTFTGSVGDVNIDNTTVEIVSILPGGI
LRRGNTVLEPGNTITIGETLNFTPPENITTSGSIQAFTVRASDGVSESNVIPVAAGIEVT
PPLDNCQILPSACKPINGNGNKKDVVINGGTYTPYPEDKFTDKFASQLGISRPKVKTTED
AIDLVRQIEKATGVKPALIYLSFVPVEIAPNTATGNTKSNKVLDTVGESDRDQLEIVVVT
GQGNPIRKRVPSATRAKVLQVAQEFRDQIVNPQNRRTTGYLQPSQQLYSWIIAPIQQELQ
AEGIDNLVFLPDVGLRSTPMAALHDGKQFLVEQYSLGLMPSLSLTNTAYTDIKQSQILAL
GISQSTQGQQPLPAVPVELSTLVSKLWPGKLLLDQQATLENLKMIRRQQPFGIIHLATHA
DFIPGPLSNSYIQLWEDKLHLNQLRQLRLNEPQVEMMVLSACRTALGDEEVEIGFAGLAV
LAGVKTSIASMWAVNDTGTAALMTKFYESLRTAPIRAEALRDAQMAMVKGQVFIKDGRVQ
GLETVPSIPLPAESIQETDLKLTHPYYWAAFTMVGNPW
Download sequence
Identical sequences K9QQN8
gi|427728497|ref|YP_007074734.1| WP_015137593.1.5551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]