SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427728572|ref|YP_007074809.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427728572|ref|YP_007074809.1|
Domain Number 1 Region: 129-290
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000349
Family Serralysin-like metalloprotease, C-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427728572|ref|YP_007074809.1|
Sequence length 325
Comment hypothetical protein Nos7524_1331 [Nostoc sp. PCC 7524]
Sequence
MDTYVGTRGNDRKPQDFTPPLPPFPSAISNSMVYGDTDGELNDNQRGGNDRIEIVGNDNR
LFGDAEIMRDKARGGDDMLTLLTGNSNILIGDAVFMLGNARGGNDKLTAIGNDNGLIGDA
VAMSGNARGGNDKLTTTGNDNGLAGDARNMLSNARGGNDKLTATGNNNFLYGDAAVMRDN
ARGANDKLIATGNNNSLYGDATDMYDNAIGGDDILIASGGVNTMWGDAELLGTGVITGRD
IFVVQKGVIPCLSGDMDYNIIKDFRPGEDRIGLSFGLFFHKLYFGVDHCNHTTLNIFSDS
TQTDLLAKVENVTALTRNDFVYFFG
Download sequence
Identical sequences K9QQW7
gi|427728572|ref|YP_007074809.1| WP_015137666.1.5551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]