SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427728589|ref|YP_007074826.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427728589|ref|YP_007074826.1|
Domain Number 1 Region: 6382-6717
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 8.89e-32
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.022
Further Details:      
 
Domain Number 2 Region: 7267-7383
Classification Level Classification E-value
Superfamily PKD domain 0.0000000667
Family PKD domain 0.0036
Further Details:      
 
Domain Number 3 Region: 6982-7092
Classification Level Classification E-value
Superfamily PKD domain 0.000000536
Family PKD domain 0.0064
Further Details:      
 
Domain Number 4 Region: 7393-7476
Classification Level Classification E-value
Superfamily PKD domain 0.00000183
Family PKD domain 0.005
Further Details:      
 
Domain Number 5 Region: 7599-7750
Classification Level Classification E-value
Superfamily beta-Roll 0.00000418
Family Serralysin-like metalloprotease, C-terminal domain 0.0011
Further Details:      
 
Weak hits

Sequence:  gi|427728589|ref|YP_007074826.1|
Domain Number - Region: 7064-7179
Classification Level Classification E-value
Superfamily PKD domain 0.000143
Family PKD domain 0.0044
Further Details:      
 
Domain Number - Region: 7774-7803
Classification Level Classification E-value
Superfamily PKD domain 0.00118
Family PKD domain 0.0073
Further Details:      
 
Domain Number - Region: 4986-5036
Classification Level Classification E-value
Superfamily Diphtheria toxin, C-terminal domain 0.0353
Family Diphtheria toxin, C-terminal domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427728589|ref|YP_007074826.1|
Sequence length 7807
Comment 3-carboxy-cis,cis-muconate lactonizing enzyme [Nostoc sp. PCC 7524]
Sequence
MYFTEDNLTQPQILDINKPELLSLKSGWEITNFSNSVNPNILLPYFYPINADLINFTSLD
TSPIKGMFPVSFDDENLNIENIKKGHIDSLTGQTISGSLVLPEELIFIDSNIDDYQSLIG
GLGSNAEVIIINSEQDGIHQITQALTQRQAISAVHIVSHGGMGSLQLGGSVLHLGTLSNY
SSDFQQWANFLTPDADILLYGCHVAVGEQGLAFIQTLSTLTDADVAASNNLTGNASVGGD
WDLEVKTGTIEAKTIFPNSAIANYNGVLFTKISGAFNGTKKFTDDVFLDGNVILSNNVVF
DLDSHDFTLSGSDLKIQGDSTGDRDSLTIKGAKTVNIAAGLIGGGGFKNLTIEAETINII
DFATISTRDIDSSDFLNGISVGESGFIKLNAPTIKVSNNAKLLAHVEEGSKLKAGDIELT
ANDTGIPIGTFTIFDFKSRDVDISLDGATVKGANIVLKAESKDQNPFARAPEQVQLMLID
PFVKSSTYLLQNLLLPASVNVRSSTSKITLQDVNIIASNKVDVISTSTVDSSIQAISLVN
KFNPFSRFAVAYGQATGKAEALVKGNTNIQAGTNVKIESNTTTTARVDARVYGNILQRFG
LAANANEFGLSVSIANTKTESKAEVEEGSTITAVGNVNVNAKGTVNSQSRALAAIYLSGL
AGTGIGLNFDDTDIDANVNGRITAGGSSVGVDIDISKIDSTNDTIFLPDTRQIDLGFTSF
DLPIDNPVNGEQVVYSNGGETNKVKNTSIGGLEDGKTYTVLWLDDNTIKLTNGSSIDIDN
STVNQGAEHGFNLRTGFQFDPETVVNLDNDTITINNHGLTNGQLVAYYGDPQGEEIDILT
TQGYYFVIVEDANTIKLAYTPEDAANGVGLDLGSKGEGSNHLLTFIQERRNEISFDPETA
VNLDDDTVTIANHQFKTGQPVIYTRDPQGQEIDALLNLGDYFVIVEDANTIKLASTQSNA
LQGVALDLGTKGAGSNHILTSLESLISFDPSDSKVVNNQNNTIKIPNHGFQTGDTVVYRT
DQSIVTQQTIPINLSFDPNTSVDLTNDTITIVGHGLTTGDELTYQINYLGNPGTAIDGLE
ANQKYYAIIVDDDTIKLAASATNATDGIAINLETGAAGILHNLRSFATVTVGDEAIAGLQ
DGDDYYVVVIDENTIQLTESEIEAFLAQPIDIDASVATGTGHKLLRPEENTGIGVNANLT
AQNITTSRGVSGSYPKIRDFLGAPLAFATVSPQLLQPGTSKEMLRGDTGSPFGQMTGQNQ
FSAAVGFGLNLLEHDVIAKVGADAVLKSDTDVVINASIIQRAQTLVDTESGKGSTPGVGT
PPVGGQQGRGVSIAASTAISLYNNRVEAIIDNRLDVLGNPIRVAKIDARRNIKVTSNLIY
PFLLDFQQEFDFTNNPLDATGNLGVLLKAFALDGRLGLTNRIFNTFVTSKNRGRKDPVTK
KIDGNFAFALSFAFTQFNNSSKAIIRSGTQINQNSDYQTPTQSVSVNAKTDIITLDAGGI
VHIDLAADVIARAVLRKSADEAITIFGNRAKNGVGGTAIIQNMENETIAKIESGAVIHTG
SLGDGLEVKAKEKIISLTLGQAGGEAETFGFTGTGVGLIQDSETIAQIESGVKITGGPLS
VIAESEATRINIAGSVQLTESIGIGASFAFNDITRKTKAIIGKEQTDEDKTPGDEGTLID
VTGNINVKATTSGNIWGFSLAGSIAVKLPTDVDNPNPFGISVSGSSSINDIDETTQAYIN
DVGSITANNGDVKLESINDTLFVAASGGATLAFGQAVSFGLFGAFSINDIDHTTQSFING
ATVKARQVTTKAEKQAIVSAVAVGLSGAFAREGQPGVGVQVSIPGSYSRNVLRNQTEAFL
TDAIIDANSDLIVTANDSSDIYAIAGFAGFGTASISVTVGYSAATNENEDNKIRAYIENS
SITTRGIVDLSATSNSKLFALTVGGAVVGSTPAGTANSPISVNIAGAGAGSENTISGITE
VFIKASNITVFENNPDNALVTLKAEDDSEIIAAAGDVALTIAPVAVPSAAVSVGTSAAIN
DISNDIYSYIDHSTISTLGNVELNATSNAEILAVTLSGTASSVLSGSTKSLALAGAGSGS
ENIIKNEIETAIKNSSNISSNNVKINAKDNSSIEADAGGFSLALSRAIGGATFSPSVGAS
ASVNDIDNNIKSYVDNSIINSLGAITITAVSTADIKALSIGGSIAGVSGDSLSVAFAGAG
AGSGNTIKNTIAATIENSSNVSSIDTVTLEAKDKSKIKADAGGVSIGVALSGFQGSNRVP
ISLGAAISTNDIKNSIQAYIDKSTINSSAGGVSITAKSEEADGGNNIEALSIAGAISVAN
QFVSDLQPGSLGGATLTLSGAGASSYNIIKNTIKATIRNTADVDAKEDITVTATDTSKIS
ADAGGLGISYSRALRGSPVGISAAIGASNAFNDIDNKIQALIENTDTHVNSATGGISVSA
TSTATIENLVLGGSIAVNAPNTTTGGALAGGGGIANNEINNTIEAAIKDNAVVTGKDTIS
ISAIDTSTITSFAGGGALSSTISNRNVAIAIGVALAKNTIDNQVSAYIDQAKVSSTSNNI
EITADSDATIEAISIAVSIAIAATSQQTPTSFALSGGGADAKNYILSDTNAYIKDSTIDN
VTDLNLKAENTSNIVAAVVSIVGSTNFAIGASVANNFIGYKEDGTKSETSVNDIRAYIEN
SSITARGNITQTATFGEKDLDTITAIVATGTGAVGGTGLLSALPKTVLLISVYQAQLRTD
QSQTRSTQYTGPNTAITGTLAIALAENKVATQVQAFINQGSSTGISANNLILTANDITKI
KADVGAVTVAVSLATENNVAGAFGASVARNTISNTVQAYIQSADNTATATTGGLTLEAIS
NATIDAAAVGVSGTGAIGDKVSAALNGAGAEATNDIKNTVQAYIDSSTIVANAGLTAIKA
QDTSKITADAGGATYGFSGSNNNSISIVIGVSLARNTIENQVSAYINKATVSSPKNNIEI
TADSDATITARSVSVSVAVSFGQNLSLGLSGGGAEATNVILTDTDAYIKDGSISDVADLT
LKAKNTSKITATAVAISGSTNAGSLQSGAISVGVSVAVNEIKNNEVLAYIDSSEVDAQGD
AALTATADADIQAYTIGGTVSASAGTGTPAKPGLAGALAGAGAGSGNTIENTIEAAIKNS
SNVSGNSVTLIAKDESQIIAGAGDIVLAFAGENTNNISGAISVGVSAAVNEIKNEILAYI
DKSIVDAQGNVALSATATADIRAYTIGGTVSGTSGTGSGSGLSGALAGAGAGSGNTIENT
IEAAIRQSSNVSGNVVKLTATDESDVIAVAGSVAFAFVGASNSSAVSVGVSVAVNEISNE
VLAYVDNSTISAQGNVELTAESTAIIGSYTVGGTASVGVPSNTSAPFAGTGAGSGNTIDN
KIEAVIKNTTVNGNAVILSAEDKSEITAGAGTVVGAFTVGGRNSLAVSVGASAAVNKISN
QVTAYVDSSSITAKGNLELNAISKSKILAVTVGAAGSASITQNSGAFAGAGAGSGNTISN
KIEAAIKNSAEVNAQDVTLLAKDDAEITAGAGAIAFAIVVGNKAGVLSVGVSVVENEISN
TVRAYIDNSIVLTTGAVNVTADSTTEIAAYAETGALSVGALAGALTATSSTNKTKNTIEA
FITNGSTVKTSNSGNVNLKANDDATIIANSTGGNLAFSFSIGPAITIGIVKADNDVSNTV
RSYIARATIVTADGSVNLLSESKSNIDANSTATLLTGGISQYGASISGGGAVAKNYIAKT
VEAFVNNLSTVNTTNGGVKLGAIDHSKVKSEVGIGSLSGGMIGGSLGLSIADNTIENQVR
AYIDRATVTADGDIDINTTSKSDSQALAVATSVGLGGGTVAEAGAFANAQEYSNVQSYVG
SDSRLNALNIDVTATRNIENNFAKTSGAIGNLGGINFAIGISLATVDVAGSVDAYISGAS
VTAKENLNINATLLTPVAKPNPGILSGVEGVFAKSEAIAGGLGVAGGSGTGTTAKVTVDP
TIRAYISNNAEIKADKDISLTADSQIDAATDVVGINVNANLGGLSVGVTLADTKINPDVY
TSINKNADVRAGGNLTLQSKHNFDQTEPFFYRNALANATAPITLGTLGAGTGADAKATSS
ADVQTSVESGATIHAGGNISIVSRAYNDAISDANGLTIGGVAGVGTSVADAAARGKTTTS
MNGAITGASNILILTDARNFADASGVASGGGILFGRGTVVNSDVDADTSASVGDNAKVDG
VRGNITIESRSTTDAKAKGTGKSGGFIGVGVVETEADITNTNKAAVGEKVEISSSKNFQL
LSQSQNKAVTESIGGSGGFIDVSEAETTVNINDQTTTDIGNQSTITALESLKVDAESKTY
VDAYADVNNGGAGTGGITDTDVTIRKSTITTVGSATLKADEIELLARVREIDINRAKAES
RSGAAFSVLRADANVNTESDVKVEIKQKADIEGRERVDIKALQEKLEIISEGRTRLNAVT
GEASPSAKTILKTDTRVNAQTDSEITTRELHVEANAPQSIKFDYKTERAGNTITTTGGSK
KSGELDLIRKIDFNSTVIMLGSANPILEIDADGNVVKQVNVNFQQTQTEINVADIRNTDA
LWGKITFLINDQVNYTERDNLKTTLEAAIVGTPKFEFITGFGSVDITNRSAKNLRINAID
VLNPSTEFSSTVIVNVKNRAGFSPKFEQSPGKTQINIENTSNADIRLNGVISNPYGSTKI
INQGGNILSTRASAEIATTTLTLLANNGSIGSNSNRIRTKSSLLRAIARNDIFINEFADD
LLIDEIISTLGNVDLTVNGSILDGNDTTAADISAKKINLNALKGSIGSNTNPLEINATDT
NGLTATAAADIIITDIDGSLSINKVLSLQGNIKLMLPDLLNPGQDLVLGASSSIRADEGA
ISLLVGDNVHLGTGSAIAYGGRNVIAAATSVTINGDWGNADIGVGTTIELNGKIKANTVL
IQGETDGDTISLTNVEDGVITTIETGDGDNKIHIGSQATPTSNTGGLLDTIRGRVIIRGG
ANTDRLELDDTGDTKTNIGTLTNNQVTGLGMALGIEYANIENLNITLGAGSDEFAIHSTQ
NGTLTLVDTGAGNDIINIGNNTNQINEIAGLLEIRGGTGTDTLNINDQGDITNNAGILDT
NRLIGLGMGATDQTVINQERGIIYGSLERLNISLGSGNDQFIVNAINTETIINTGAGNDN
LTVEDELPRIAARLMVEGGLGEDILSVNSKIASDLTLDTNIITAPDVSGLIEFEEIASLI
VTQSDSNDEFTILNTTTALTLNSSGGSDLVTVENASAPVKINIGDGDDQVTIQNTNANIT
INGDGSGFDKVTVDRSSQTAAIIGGLLRDGTQANTGIVENLTTGDIVLSTIEQLELKLGK
GNDDFTINTTLPNTVVTVKGDDGDDSITVRSIGSPETNISGELGEDTVTVIIDGIPTDKQ
FTNLNLDIETLVVDNSTNTSQPVDWTLRNGAVLEAKIVPDTTTISVINTEGAELTRILGG
TQADTLNVVTETTNNIEGFIDGDRVELRSGLSVLEPVGFDTFTNYDVVINFDKPLTAPNK
FEQAGFQLVSNGTVVIDNSISPAAKAGSSNDTFTFTSATGAGFALYSLSLAATTPGTQNL
TFTGTTMNGGTVTHAVTVEGNTGFQTFNFPTSFGALKSLSWQPGTTLVDNIVAKEWFPNT
TAITLESVPVLYLAGNIVFDTDRLQIRVNNSVISNNSLFTSVINGNIAQFRFAGDINFAN
NSRVTGVGSRGLSLLAGNDVNVGTNATFDFSGSGINPGIGGGRGGQFGFGGDAYLERTPG
GDGGSGGDGGSRGGEGSGGSRGKNGATGGSGQIGKDGGNGYSGENGLGGINNLNGGGAGG
AGGAGGAGGKQTIAIPVLTPTGIIFRQTSIGAFGGAGGDGGSGGGFASNGAGGKGGSDGQ
DGRDGGTGATGGNGSAGFNNINGQLISGGGGGGAGGGGGAGGNGGGGGGGGGGGGGGGSG
GTVFTRGRTGGDGTDGVKGSPGGIAKEGGFGGPGGGGGGAFEILANGRVNFINTANLLSK
GGDGTPGSEPTFVSGLEGFFKGEQGYKFEYSGRDGSSGSPSSGGGGGGGGAGGDGGDGGR
GGTGAGGAGGTVKLYGTTVNAASTTVNTSGGSGATTGGDGRLIIGSNTYAGSLPGTRTGA
TTSFLPGQRAGNPYLNSFYFNFQTITPYIAGVAEGANIYGILSGLDGRLLDYNLSTPEID
KPPVDALVAVYRLDLGPTGFNQDYGNYSGGSKTADFDMLLFINLTDTVLTNPTLGILPTN
FTSTISQNLLNGSKTLTALNPGAVWATLIPSNVLIRNSRNGQVTTSNAVKVNATISGPIT
SINKTLIDGEVAYIRATLPDLNVTPNITGLQSIALSPDSKQIYGVNPTQNALVVINSNGL
TQRQLFKDGLEDMDGLAGASDLVMSSDGKHIYVASPGDQKISIFQRDLVTGNLGFIETIG
YSKQVFESVAINNDNSRIYAAGNDGIAVASRDSNTGKLTPIQIALNPDGISGFTNLALSQ
DGSLLYAVSSSSDTLVVFNTSDLSVIQKITGAAQGLDGAKGLAISPDNRYVYITGQNGNT
LSVFQRDGSSPTLTHVQTLQNGVNGIRGLLGASDVSVTPDGKYILVSGTDSNAVAVFYQN
TSNNKLQFVQLLRHNVGGAIGLQTPTTIVTSGSQTYISSLGTTGNSGGLAIFDTNTLLPE
PVTLRTTFDNIEALGVSTASGEDIITLRQAPSPIVAKTSINTGDGDDIVTLQDLSPTTIV
NLGAGNDTTQLRTTTPKAHLTLRGESGDDTINIERVGEFSRTEVFGGDERDTVRVSGGNL
PGTATTIAHGDDPNNVPQTQGDTLIFDPQNPDPKTPNYTPVPPTPRAGKVNVIDKGILEY
DTFEGDVIVIDAPIINFINEPYQIAEGESLTLQVNVTPLGLENKLSEPVTWDIDGDGRFG
ELSDDTITLSWQQLVDLGLGDDGTYQIAVQAINTDGFTSNALTNLTIINTPPTIQVSGAN
EVAVGTPYTINFSATDPGNDRVFEWRIDWGDGTPIEIFGSNTTSATHIYTNPGKAQILVG
AVDEDSAPNATFAALKTVSVIVSANQVNAGGPYTIAEGEALTLNAIAVGTPTAYSWDING
DGIFGDATDENPTLSWTQLQQLAANPIQNNGTYNVRVRVNYGTDQQATSNAVNLRVMNTA
PTANLVNSGAVNEGSTTTVSFIDQFDPSLSDTTVGFLYSYDFNNDGQFEIINSSSSSVVV
PAQFLSDNGISTIRGVIQDQDGGATELFTDITVLEVAPTLIVSGADTAIEGASYTLNLSA
TDPGNDTVSQWVVDWNDGTVETFAGATQSLTHRFTDNGTRVIVVTAIDEDGTYTATKTVT
VSNTAPQLQNLSATTAVEGGISRLTGRIVDPGTQDSFTLLVDWGDGSSETFNLAAGTTNF
DLSHQYEDNRDYMITVTVTDKDGDSDTATTTARISNAAPTITGLILSNTTVAEDELVVVS
GIIADTGVVDTHTVVIDWGDGNASVATVDASTRTFAASYRYADDNPTGTPVDDYMITATV
TDKDGDSGSASTAVNITNVAPVITAFQLNETTLNRNRVVSMNGEFIDVGVLDTHTVTVDW
GNGITSNAVLDAATRTFTATYEYKVISGDGSRNALVGTDGNDRIFGGVGVKTLTGGRGSN
EFIYTDIRELGHRITDFKVGHDKINLSQLLDNLVPGGYQGTDAIADGYVRLVQGSTTNST
ILQIDRDGQSGSAVFRTFLIIDNVGVEHMNDPNNFIYNDVGHYTVTVTVSDDDGGEDTTT
TTVSKLI
Download sequence
Identical sequences K9QQ64
WP_015137683.1.5551 gi|427728589|ref|YP_007074826.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]