SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427728610|ref|YP_007074847.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427728610|ref|YP_007074847.1|
Domain Number 1 Region: 70-365
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.39e-48
Family Filamentous hemagglutinin FhaB, secretion domain 0.0071
Further Details:      
 
Domain Number 2 Region: 433-563
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000000173
Family P22 tailspike protein 0.099
Further Details:      
 
Domain Number 3 Region: 564-692
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000292
Family Filamentous hemagglutinin FhaB, secretion domain 0.057
Further Details:      
 
Domain Number 4 Region: 651-756
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000107
Family Filamentous hemagglutinin FhaB, secretion domain 0.029
Further Details:      
 
Weak hits

Sequence:  gi|427728610|ref|YP_007074847.1|
Domain Number - Region: 726-851
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000248
Family iota-carrageenase 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427728610|ref|YP_007074847.1|
Sequence length 1015
Comment filamentous hemagglutinin family domain-containing protein [Nostoc sp. PCC 7524]
Sequence
MRDKQGIKCFRKLFVFGLAISALSSVIGGKTPVLAEIQADTTLGRQLSIFNQGVEVKGTI
GDRIDGGVVRGANLFHSFREFSIEDGQKVYFSNPAGIQHIFTRVTGNNRSEISGTLGVLG
NANLFLINPQGILFGSNATLDIAGSFAASTADSLLFANGLTFSATNPQVPPILNINLPLG
LQFGTNTKAIQVQTVSDTGLVVPTGKTLALVGGDVRLEGGILQAAAGRIELASIRGVGIV
GVDVAGDRLKLNFPDVIPLGDIFLSQAALVNVSGEHAGDIQVQGRQVSLTEGSRLVTNTL
GTQSGGSLQINATESLDLSGTNINGNPGGLFARTFGSGNAASITIKTSKLTAQQGARISA
ATFDRGLGGDLLVNASQSVEVIGTTGRGNRPSAFFADSEGSGNAGNLTINTERLTLRDGS
LISVGTGGDGQAGNLMINASQSVELLGTTPDGFLPSELAAFTLGHQDAGKIEINTHKLII
QDGAAIFVSTFGAGEGGDLTVNASDSIKVSGTGKVGDIVFGSALLSQSEKSATGNAGNIE
INTSKLTVSDGGLISASTFSPGNTGNISINATQFVDVLGTSPNDEVASQILTQVNNQATG
NGGELKITTRQLNVRDGGIISTSTFDQGNAGNLTVNASESVEVSGFSPDGFSSGIFTNSY
RTGNARELKIDTKRLIVSNGGVVSASTRGVGNAGNLTVIAQESIKVIGSEVGENRTSRIA
VRSLGDGNAGNLQIFTPELLLQNSGELNVNASGSGNPGNLNITATNIFLDQSKINAETAF
GSNANIALQVAGLIVMRNRSLISSQAFNKGSGGNININTNFIVAVPNEDSDIIANAFEGS
GGKINILAQSIFGLLPRQRLTSLSDINASSELGINGFVEINTPNLDPSSGLVALPENVVD
ASKLIAQTCRGAGEATASQQSEFVITGRGGLPSKPSDPLSGDAIWQDLQSYTLLNEKLTT
SGQETNSVSPQPADIIEAQGWVTNTDGKITLVAQSPTTTPHHSSRTPVNCPVAQN
Download sequence
Identical sequences K9QNP2
gi|427728610|ref|YP_007074847.1| WP_015137704.1.5551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]