SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427728612|ref|YP_007074849.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427728612|ref|YP_007074849.1|
Domain Number 1 Region: 6800-6988,7064-7159
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 2.28e-20
Family YVTN repeat 0.0039
Further Details:      
 
Domain Number 2 Region: 4189-4370
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 2.81e-17
Family SGL-like 0.057
Further Details:      
 
Domain Number 3 Region: 8248-8335
Classification Level Classification E-value
Superfamily PKD domain 6.02e-16
Family PKD domain 0.0019
Further Details:      
 
Domain Number 4 Region: 8422-8494
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000000615
Family CalX-beta domain 0.003
Further Details:      
 
Domain Number 5 Region: 4662-4751
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000232
Family Cadherin 0.012
Further Details:      
 
Domain Number 6 Region: 8333-8419
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000000353
Family PKD domain 0.0015
Further Details:      
 
Domain Number 7 Region: 6101-6162
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000275
Family Type I dockerin domain 0.0027
Further Details:      
 
Domain Number 8 Region: 1332-1427
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000514
Family Cadherin 0.0028
Further Details:      
 
Domain Number 9 Region: 5442-5517
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000534
Family Cadherin 0.011
Further Details:      
 
Domain Number 10 Region: 4762-4843
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000769
Family Cadherin 0.066
Further Details:      
 
Domain Number 11 Region: 4935-5050
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000111
Family Dystroglycan, N-terminal domain 0.08
Further Details:      
 
Domain Number 12 Region: 5052-5150
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000502
Family Cadherin 0.024
Further Details:      
 
Domain Number 13 Region: 4849-4933
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000706
Family Cadherin 0.044
Further Details:      
 
Domain Number 14 Region: 1540-1624
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000733
Family Cadherin 0.015
Further Details:      
 
Domain Number 15 Region: 1441-1525
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000157
Family Cadherin 0.016
Further Details:      
 
Domain Number 16 Region: 5259-5344
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000022
Family Cadherin 0.028
Further Details:      
 
Domain Number 17 Region: 5347-5436
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000408
Family Cadherin 0.04
Further Details:      
 
Domain Number 18 Region: 6385-6423
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00000173
Family Invasin/intimin cell-adhesion fragments 0.01
Further Details:      
 
Weak hits

Sequence:  gi|427728612|ref|YP_007074849.1|
Domain Number - Region: 7704-7839
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.000266
Family Matrix metalloproteases, catalytic domain 0.029
Further Details:      
 
Domain Number - Region: 4316-4500
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00306
Family Methylamine dehydrogenase, H-chain 0.089
Further Details:      
 
Domain Number - Region: 5158-5257
Classification Level Classification E-value
Superfamily Cadherin-like 0.00408
Family Cadherin 0.043
Further Details:      
 
Domain Number - Region: 4026-4102
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0738
Family Fibronectin type III 0.0059
Further Details:      
 
Domain Number - Region: 5859-5947,5978-6010
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0746
Family Quinoprotein alcohol dehydrogenase-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427728612|ref|YP_007074849.1|
Sequence length 8587
Comment PDK repeat-containing protein [Nostoc sp. PCC 7524]
Sequence
MELNQEDFLQVAATQLDSQQLAIPDLLGDPLSGKLEQLSTEPLLDINWSANRESSQETVI
AYGEPTSFIEDPLVGSLTDTREILYWQGGSGFWDNPNNWSAGRLPGANDEVVIDVPQEVT
ITFRQGSASIAKLTSQENLVISGGSLTILDEGLINNNLTLSGGTLNTTGTVTLQGQNQWR
SGTISGTGIVNIAAQSNLDITTSGYKGIRGKVTLNNTGTIIWDGGYVDGDYNSAEDVINN
QGIFEIQNDNYLYYLTFNNSGSLIKSGATGTTNFYQSQFHNTGTVDLQSGNINFNGGGSS
NGGTFKLAANTTAQWSDDYTIDANSIFTSLGTVQVSGGNVNFQTNIDVLPNLLVSSGSLT
LASQTLDVAKLVLSGGTLNTTGTLIIDDFTLSGGTLNTTGTVTLQGQNQWRSGTISGTGI
VNIAAQSSLKITTSGYKGIRGKVTLNNTGTIIWDGGYIDGEYNSAEDVINNQGIFEIQND
NYLYYLTFNNSGSLIKSGATGTTNFYQSQFHNTGTVDLQSGNINFNGGGSSNGGTFQLAA
NTTAQWSDDYTIDANSIFTSLGTVQISGGNVNFQTNIDLLPNLLVSSGSLTLASQTLDVA
KLVLSGGTLNTTGTLIIDDFTLSGGTLNTTGTVTLQGQNQWRSGTISGTGIVNITSQSNL
DITTSGYKGIRGKVTLNNAGTIIWDGGYIDGEYNSAEDVINNQGVFEIQNDNYLYYLTFN
NSGSLIKSGATGTTNFYLSQFHNTGTVDLQSGNINFNGGGSSNGGTFQLAANTTAQWSDD
YTFDSQTIFSGAGTVQVSGGTVNLNLTTVNLPHLVLSGGTLNTTGTLIIDDFTLSGGTLN
TTGTVTLQGQNQWRSGTISGTGIVNIAAQSSLKITTSGYKGIRGKVTLNNTGTIIWDGGY
IDGEYNSAEDVINNQGIFEIQNDNYLYYLTFNNSGSLIKSGATGTTNFYQSQFHNTGTVD
LQSGNINFNGGGSSNGGTFQLAANTTAQWSDDYTFDSQTIFSGAGTVQVSGGTVNLNLTT
VNLPHLVLSGGTLNTTGTLIIDDFTLSGGTLNTTGTVTLQGQNQWRSGTISGTGIVNITS
QSNLDITTSGYKGIRGKVTLNNAGTIIWDGGYIDGEYNSAEDVINNQGIFEIQNDNYLYY
LTFNNVGTLIKSGNTGTTTFYYSQFHNTGTVDLQKGKLSFIAGNFVNSSGQILQNGGIFD
TAGSSFVEDNQLPDLKITAANAPTNTKPGSSIAISWTVANVGNDVTNVSDWYDGVYLSQD
DIFDFTDTFITRIAKPKQLAINSSYTVDRTIILPEIATGQQFLIFVADEKYNQVEAQEAN
NFFAKAIQFLNVNNNPPTDIELTNNQVNENSANGTLIGTLATTDSDIGDTHTYKLLDNAE
GRFFLDGNQLKVANGALLDFEINNQYDIVVQTVDQGGLSFDKTLTIQLKNVNESPVNIQI
SNSSVDENSPNGTEIGVFSTTDLDGVDTHTYILVDNAGDRFQLVGNQLQVKQGDLLDFEA
STNHQITVRTTDAGGLSFEKTFTINLRNVNEAPTAIQLSHTNINENSPNGTVIGNFTTID
PEGGTNYSYSLLNDAQGRFKITGNQLVIADGSLLDFESNTNHPIIVRSQDVGGLTVDSTF
NITVNNLQEPDLTIQLTSVPPNAQFGTAFNVTWVVKNVGDDPTTNNWSDRLYLSTDSAIS
QDDILLVTKAASQTPLSPNGQYLQTASITIPLNQNSLAGQYYILVETDTFKNQLEINETN
NIAQQILQLTLPELPDVLVSNIVLPSTARPGQTVNIGWLVTNQGQGIAQGAWVDKIYLSV
DGTLNGATLLSSVIRNVDLAANQTYNASANVVMPSVADGNYQLVIVTDGDNAVFEGDKEN
NNLLVASTGLTIGNPDLVPTITSAPQTATSGTTISLQWNVKNQGLLKTSETWLDKVYLST
DNQWDSQDILLAEFNHIGELANNQSYNAELNVNLPIGARGNQYLLVVTDSNNQVNEGNRE
TNNTAAAAINIQLAPYADLAVSNVTAPTLTIDDPATVTIGWQVTNLGTGTGKVNSWVDRI
IASTDEIVGNGDDRILGNFTHTGFLEVNASYSRSETILLPPAFQGRYRLFVQTDATGLVY
ENNSETNNADQAPQFFDVMTKPYADLVISGLATDATGNSGQFLNISWQVKNQGIGITDTS
SWSDTVRLAKNADGTNVVTTANFQHVGSLAVGGTYNRTVQLPLPNGLQGEFYVVLDTSGP
FEFIYNNNNRFIFSNPVTINLSPAPDLVVTDITAPTAIKAGKTIDVSWTVKNQGLGAATG
QTWTDSIAIREVGNPNALAITLRSFTYDNNLGAGNFYQRSEQVTLPNNIQGLYQVEVTTN
VGGSLFENGATNNNRSVDDQSIEISLPPLPDLQIIELEAPDSISAGGAIAVKFVVKNQSQ
AVATSTPRWKDHVYLSLTAPQNNLIPGDALLLGSLDNGAALAPTESYQSQISNLVIPRNY
RGKAYIIVKADAGNQVNEYPQDNNNILFKEIQINPLPPADLVVSNVVANDQAFDGSTIEV
TYKVTNKGVGETDRNTWTDTIWLTRTKKRPSPIAQGSEGEGAAFDILLGTFSHTGSLLVG
ESYEKTVRVKLPDHLSGEWHITPWTDAYNVVTEDTLTDNINPDDPNEVDNNNYKARPITV
LLTPPADLIVESITPTAQAVGGQPFTVKWTVKNQGTSVTSSDTWTDYVYLSDAPQLNVSG
AKYLFLGAFNHNSQLNPDQTYTTERTFNLTPAANGQYVIVITDPNIGGGSVWEGDYENNN
SLSVQTNVTAAPADLVVTDIITQQQNFSGEQTTIQWTVKNIGGAMWSGTRFWTDRIYIAP
DPTFIPSRAIELGSVSYSPEQPLGTGDSYTQTKQFTLPRGIDGDYYIYVFTDIGTGIIDG
GNNDESRKFYLSHGFEDPSNNSNVKPIPVTYREPDLQVTDLVVPTQKPSSGQVIPISWKV
TNLGTRDTREAGWLDRIYLSRDPSLDNSDQLLGTYIRYGGLAKAASYQATQNVTLPDGIE
GDFYILVFADSNITGLIPPGGPGVDFEGIDRELARVGEFRDEGNNITSAFLPIALTPPPD
LQVTAILGVPERTTIGQSFNITYTVSNVGTGDTSALQTQWEDLIYLSRDPFLDLQSDRYL
TRVQQYNKTLKAGESYNETVTLKLPTDLSGPFYVFVVTDPQRHTPRGQVFEGNNETNNAT
PSTPIILEVPPPADLQVGDITVTGAVKSGEPINLNWTVTNYGPNAAKGQWSDSVYLSSDA
IWDIGDRLIGRFDYSGEIKPGESYTGQLLPSQAYLPAATPGQYRIIVRTDIYNQVYEAEN
EVNNITPAANPVNVTVDKLQLGVSLPTTLSTGQERLYQIDVGFGQTLKVDLTTAANTSTN
ELFIRYGDVPTPFNYDAIYTTPLQANQSVIVPTTKQGTYYVLVRGQYAPSNNTPVTLLAD
VLPFSITNVATDRGGDGKYVTTHIYGAQFHPNAIVKLVRPGFAEYEPVSYKVIDSTQIQA
IFDFTDAPHGLYDVKVINPDGKQAIVPYRYLVETALEPDADIGLGGPRVLSPFPTGNIGR
YGVSLINQTNLDLPYVFFEFGLPELGKNGEFFGLPYVTFNTNLGGTPEGLRDIPWASLAS
EVNTTGEILAPGYAVDLETRGYAGLNFTAHVYDGIEELLAQNPKLLETLDEDLDLAFKFH
ILAAATPMTRDEFISKQRQEALKLRQKILADQTTSQGLIVLAANEENWIALYLTALEQAG
LLRPEDQPPPVRENPYLVSLMATLSSGILAGPAGNQIVTNGNLVAFFAQVRQWYGHNPEL
LGNAAPPPASEYDQQLTQRTRFEAFNIYVPHKTRLDLPGFVEVNPPDFSRFFSGVVSNQL
ASITGPLGFGSDQFIPTGQALPYTINFTNAANAASSPSQIQIATQLDPDLDPRTFRLGGL
QIGDIQVHIPNGRGTFQGDFNFVQSQGFILRVNAGLDVTTNTATWLLQAIDPTTGELIQG
RDVGLLPANDANGAGTGFVTYTILPKVGTATGTEITATAGVEFNTTAPEQTLATVHTVDG
VAPTTTVTVTPLVPGGSDYQVEWQAVDDTNGAGVKHVTVYVSENGGNFVIWQRQTTETSG
VYSGQAGNTYRFIALATDNAGNREQPQLGIQAPDDGSSVNLGTLPSIPGTTTPDLGTAPT
PNPQPSPQTNPLFTEAEKLIPVNLDTTRESEFSTVLRPFIAEAFATGILPSHGNIGAMAI
AVRTDGSVITSGGRGRNQLFILPREGGQVGTALATLPYPIFDLAFDSQGNLWAATGGGPL
LQLNPQTGAILQEFGDSITQTLAIHPTTGLIYVSSGNGIEIFNPTTQTFSHYSDLRVGNM
AFDSNGDLWAAVWPERGDVVRFGADGKPQKMLQFATPVDSLSFGKTGSTLEGLLFISNNS
GVKPNTPSQLIMVDLATLRWVAVAQGGSRGDIVKTTADGRVLLSQSQQIDVLSPLLPPRV
AATNPAPNANVTLPNSTILVTFDQDMFVGAATDTASVTNPNNFRLTGENVGTITPQQVVY
DAASRSALLTFDALIPDKYELLVESTVQSRARLAMTADYLGNFTAISDFSALVDFAFANP
RSDRGDGTISYEVTITNKADYQLQLPLLLLLQPAPYVTGQPVGTVGQNQEGAYLLDLSAS
LPSGVLDPGAAISARTISIQNPEQLRADFAPGIYALPYPNQAPQFTSNPVTTATAGQAYS
YQATAQDPDGVALSYLLYSAPAGMTINSSTGLISWTPTAESAVATPVVLRVYDSRGGHST
QSFTIQVAGGNSTPVLEALPEEITGREGELLQIAISATDADNQRLIYWADNLPGGAVFDP
QTRILSWKPGFDAAGTYANVQFFVSDGLQTSSQSVTLLIAPQNQAPNLIRPSDRTIQEGD
RIRIPLIATDPENQTLTYISTLLPPGATLNPQTGVFEWTPAYFQAGEYEIPFSVSDGESV
TTKVTKITVLNVNAAPVFDNLDRWQIQEGQAINFRAFALDPDNPGFIPQIRNSDGTLTPL
EGSEPTVTYTVTNLPTGATFDPATAIFSWTPGFTSAGNYIVTFTATDNGDGTGVNRATTV
NVPIQVLNSNRPPQIQPLDNRTIQRGEVLEIPIQVIDPDGNPVVITAQGLPGYDIPSFAT
FTDNGNGTGLLLLTPGMNETGDYTITFTATDNGDGGGQTAILSDEYTFVVTVDAPNEAPK
LNFLGNRVAVVGETLQFTVQVSDRNQDPLNFTTVSLPPGATLTNTSIYGQAIFNWQLTLA
DVGTYTSTIKVTDSGNGDSNQALSDQKTFNIVVRTANQAPVLPAINPQVINKGQTITLSL
NATDSDGDTITYSSPNLPIGAVLDPVTGIFTWTPNFSATGIQVIANDGNKSSLQTFSVQV
SNANQNPVLIPLPAQFGRENTLLQFTLAANDPDGDTLTYAPISPLPIGALFDTQTRQFRW
TPGFEQAGDYLLKFAVFDPQGASSSIDVPVSIENVNRPPTLEVTNHNAVLGQELTFKLVG
QDPDLNTTLTYTAQNLPTEANFNSQTGEFSWIPNPGQAGDYVVTFAVTDGAATTTETALI
RTAINPPVLPVAIEITPSFASVPNQKVLIHATANSLAGITNLTMTVNGQAINLDAQGRGE
FTPQTSGRFIVEVTAKDEDGYTGTGQTVIKVRDPQDQLAPVVSFAPGLNGAQIATTTDIM
GAIADTNLDEWVLEIAPLGSKAFVKLASGNTPTNTTLSQLLPDALNNGFYQLRLTARDIS
DRTSTTTATVEVHSPSKSAQYTRTETDLSVNLGGTTIDLVRAYDSLNYAQSSTFGYGWRL
VNTDTQIQTNVPLTGREQLGVYNPFRLGTKLYLTLPTGERVGFTFQPQQQQIPGFTYYTP
AWVADAGVNYTLKSVDALLTLAGNSLYEIKTGQPYNPANSLYVGTKYTLTAPDGTIYHLD
ATGKVKSQITANGNQLIYSDSGIIATATGEAISFVHDAQGRLTQITAPDGRVLTYTYDDQ
GNLINARNLALGQSSRYSYSGDEQNLLTLVATPSQAGQAIDYSNSAPQISPVIADLGSAN
QYFGQTTNGNLTAGQIQRYTFSVRGSEILSTDTDSVLLGVEVLATGELQPGTPIIRSLTP
LFSQTTANSAFGLFSINREGLNLIEIAGANNTTTGAYSLRVFVPGDVNSDGKVDGVDSQL
MMSALGSVLGDTEYSLALDVNRDGAINATDVQILGSNFGFIANQAPVVQTATRLTHQDLE
LTIPLGSLATDPDDDPIFFRLINPVNGTVQLSADGQKAVFIPTLGYAGVASFQVLADDGF
GSSAPVTLTVNVSDAPLIDLRMNLSGAILNLGDSTQLVVTGDFSDQSNVILPLSYLSTEL
TNPQIVSLSPQGIINTREAGSTILRVSRDGLQAISSIAVDIPDEEGYGSFLGLDYLDVYP
QALTVATPGATRQLIISRGGLDFNLTSASTGTVYVSSNPKVVTVSPEGLITAVAPGRATV
TIINGVAQEDIPILVELPHIGPTPIGQGGGAVQGNDGSIVTIGPNVLEQNVTVSIAGVDA
NSLPFSAPEIFQLAGAFELQVGDKPLREAVQLAIPVASNIPVGSQVQFFRASTIVDENGQ
VKPVWLAVETGIVGADGMARTSSPPSQGVQRSGTYIVSYYPDITGTVVINATGNTGTGAV
AIASTSTGTSFGTALTSSLGFVMLLPAISWVINIFRSNPDDSVSITPTPVSVNPGLNELT
VRLAPPTATAPASDPPQITQVNYVRGDNELLIEGQRFLDANAREVNGIRLGSRNSDVEVV
FKGLNGELKRVSGSDLQVVSATQIKVLNVPDDIILGLSEIKVERKYWTLDGGFVTGNINW
ITGTKESNVARLEPKDGLAFAALSSQEMAIMNVSTGELLKKVNLGATQVAIATTNDLTRA
YVGLSNGSIAVVDAAALQELGFTAPLLPPRIVLPGNSSGEFFLAIDPDNQFLYATGPNDT
IYVIDIRPSSPTFHQVQTFSLGNTGSKIELRGLAISADGRRLYVAAAKTRLYGDNSWYKG
NRDPGQIYVVSIDPNDNAITTSNQLGIPLYRTVIKVLDVGIAPETIVATPEASKLIFTTM
LDNGRGFHTLTVLNDDPINYLAQVNTVDLTLPGSNKYALSITNAKDIAILPDLSYAFVSD
WGQPSFPGNITGDSVIRDEGRTGAKIGVIKDPFGAAKFVGATTPRWLQFAGSLALTPDGK
TLLVGYRYDNGVRVYDVQRLINTVENPGNASDLKEKPIDVINPSVEKTPFGTDAGPRDLA
TQVEAPIVVEYAGGRFGDIIKIDLKSLLAQTFASPRDFGLDIGSFVNGKVATLTFAPGNI
QPFVVQEDTQLSNLSLGNQFEDTGVFYFVPELDINKIRSEQALNASLAVGRGFFTDQNGK
RRQIQIKIQVSDTTNPFTGGGTQLGYNYFELLGTVGNGAQNNPLDVYRIEQRLQYFGFLG
WGGTFVGNQPSASSQEIKVDGLSDRTTEEAIKLFQAAVRPDNNAQSNPFGNVVTGRVNST
ASATSVDRLAYDWLNATNAPRWLELIDPDSVDNPQATPFATNNGVFDILPERNTDNPNIG
ARTGRKPQSERYGTSWAINIFRQGAGNVPGTQETAGISDIYSDTRPDVHATHKAGLDLDV
SIRNYTAIAGTTAITHAANNLSFDDQVTHYLNPANGLTAGEIQVVQEIAEYYRLTTLGNS
ELPQFNVVYIGHPANTATQPNHARIRTVLTRLGINNVLTPPHHHHYHLRLHPPTRVDLPR
PITAVQLPSVSVDNVINVSNPDLQVIAHAAISRWQSVGLTDEQLALLQDVQFEVSNLSDQ
TLALAANKVISIDTDAASYGWFIDTTPTTDEEFTQVISDWERHTNTASPIAGKIDLLTVV
MHELGHIIGLADVPVSVDPTRLMTSKLDTGIRRLPSLLDLSWDTHTEDQPVNTTTSYYSL
DFTPPTYQLTTPTLPVTTVQSIQSPATGISNGTFAISDVNTPGFGWLSRGNSTVENGQAV
IREGDRFNSGFFQTFIIPDGTKALQFKILQTNLGSTTLTPPDAFEVALLNPNTMNSLLGT
AAGLTQTDALLNIQHNGQFYLAPQVTVTGTDLLTVNIDLTGVNAGTAATLYFDLLGFGER
DAAVIVDDVVLLGDIGNTSPVAVNDQVTTNENIAVTISVLTNDTDSDGSLDTGSIVIASA
PTNGTTQVNPDGTITYTPNANFNGTDSFTYTVKDNTGTTSDPATVTVTVNATNNAPVANN
DSITTNEGSAVTIPVLNNDTDSDGSLDTESIAIASPPTNGTTQVNPDGTITYTPNANFNG
TDSFIYTAQDNEGLTSNPATVTVTVNNLTPTITDISANTNLNEGETTTFSATATDPGNDS
LTYTWNFGDNSDTVTGQTVQHTFADNGNYTITLTVTDSEGAATTQTILVNVANVAPIVEA
GENQTTATGTNISFAGQFTDPGILDTHTITWDFGDGEQVTGTLNPTHSYTQDGQYTVILT
VTDKDGGTTSDTLTVSVNSQLPKVTINDVTVNTSDSNNIYAEFTVKLSTASNSPVTVDFN
TADDSAIANTDYIPASGKLTFAPGETVQTIRVALKKPKVGDIDGDGDVDTNDMNLLLAAR
NTPATPPQGTTKAFSLLLGNATGAILDDHLGLATLMGTKYDPRDLDGDGMITVLDARKLA
LIIRHPG
Download sequence
Identical sequences K9QR08
WP_015137706.1.5551 gi|427728612|ref|YP_007074849.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]