SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427728704|ref|YP_007074941.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427728704|ref|YP_007074941.1|
Domain Number 1 Region: 51-359
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.00000131
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427728704|ref|YP_007074941.1|
Sequence length 392
Comment hypothetical protein Nos7524_1466 [Nostoc sp. PCC 7524]
Sequence
MKKIWKLPRIIYLAIAILIISFFVTNLDTGAVEISSIEFIGEATLPKGLSFQKTEVGGLS
GITYDAQNDLYYAISDDRGQKAPARFYTLKIDLSKGTLPDNGVTPVGVTTLLNNNGQTFS
SRETDTEGIAVTKAETVFISSEGDVAQLIPPFIKEFSLSSGKVQQTLPIPNKFLPDKNGK
QGVRNNLAFESLTITPDNKYLFTATENALIPDGPAAQPNIGSPCRILQYNLLSNQPEKEF
LYQTEPISSFFNITGKFASGLPDLLALDNQGHFLSIERSFTGLGFAVLLFQISLEGANNI
SNIDSLLAVDTKNIKPVQKKLLLDLRTIDAPLDNIEGLTLGPQLPDGQRALILISDNNFN
SIQRNQILAFKVKTESPITRLFRRFWPLSRNN
Download sequence
Identical sequences K9QQK5
gi|427728704|ref|YP_007074941.1| WP_015137797.1.5551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]