SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427728895|ref|YP_007075132.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427728895|ref|YP_007075132.1|
Domain Number 1 Region: 31-382
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.22e-50
Family Filamentous hemagglutinin FhaB, secretion domain 0.0047
Further Details:      
 
Domain Number 2 Region: 446-574
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000113
Family Filamentous hemagglutinin FhaB, secretion domain 0.094
Further Details:      
 
Domain Number 3 Region: 827-907,936-966
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000185
Family P22 tailspike protein 0.082
Further Details:      
 
Domain Number 4 Region: 702-820
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000691
Family P22 tailspike protein 0.061
Further Details:      
 
Domain Number 5 Region: 577-699
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000392
Family Filamentous hemagglutinin FhaB, secretion domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427728895|ref|YP_007075132.1|
Sequence length 1223
Comment filamentous hemagglutinin family domain-containing protein [Nostoc sp. PCC 7524]
Sequence
MGLSWSNCIWQFKVASLLAVCAAYTASGDFAQAQITPDSFLGVDRSMLTPNVSIGGLPAV
QVDGGAIRGTSLFHSFQEFNVGDGQRVLFTNPGGIENIFSRVTGTNPSTILGTLGVNGGA
NLFLLNPNGIIFGPNARLDLRGSFLASTAQSIKFNDGIEFSTTNPSAPPFLTLNVPIGLQ
YGQNAGRILVQGQGNELRVNQETGEVLEVNRTGGLEVDPGQTLALAGGEVVLKGGSLSAE
SGRVAVWSVQGEGLVGLTPTNPGWELTNKSVQNFQDILLSQTAAIDTSGVGGGNIQMQGR
RVALQDGSFILSLTRGNGTGGTLSIRASESIEARGNAPNGEASSFFTETIGLGKAGDVEL
NTKKLILQNGAQVSSSTFNQGNGGKIIVNASDLVEATGITATGNFASGLFSVARNGTGEG
GTVEVTTKRLVLRDGAQVSATTFSQGRGGNVLVNASESVEAIGIAPIGSSGLFAASQSTG
EGGTVEIDTGKLILQDGAQVSTLAFSQGNGGDVFVNARKLVEVIGGIPQNGNFVASSLLS
QTQGTGNSGRVEIHTGKLILQNGGQVSAATFNQGSGDNIIINARESVEVIGIAQNGNFAS
SLTAQTEGNGKGGTVEITTGKLILKDGGLVSVTASSQGNGGDILVNARELVEVMGIAQNG
NFASSLTAQTEGSGKGGTVEITTGKLILQNGGQVSSRTINRTINAGSGGDVLVNAAESVE
ILAQNGRFISSLDAQTLGTGNGGNITVNTGRLIIQDGARVNVRTTNVGSGGNIFIDASEV
VIAGSDSGLRAQTQGSGNAGTVTVKTSRFLASKGAQILAAVFPSGTGKGGNINIHASEIQ
LTGTSDNGNPTIVFATTGGKGDAGEIKIDTARLIVQNGAQIGVGTFSSGQGGNVLIKASD
SIELIGTVPQVPNLRFFRNQSGQQFPSGLFTGSQGTGTAGKLRIESDKLTLRDGATIGVN
NQGLGDAGNLEVAARNLLLDNQAVLSATTTSGQGGNMTLQIADILLLRRNSQISTTAGID
QAGGDGGNILIDSGFIVAVPNENSDITANAFQGQGGNININARSIFNLEQRPSTPPNNTN
DIDASSQFGLTGTVTINTPDIDPSRGLVELPSNFTDASQQIVSSCNPGSAARRSSFTVTG
RGGISRSPIEPFQGDVSTARWITLDTVDADQNRHVMNEILPSSPPKIVEVQGWIVDKNGN
VSLVAQVPNTTPRGLSVSSGTCS
Download sequence
Identical sequences K9QPI4
gi|427728895|ref|YP_007075132.1| WP_015137987.1.5551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]