SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427728901|ref|YP_007075138.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427728901|ref|YP_007075138.1|
Domain Number 1 Region: 186-310
Classification Level Classification E-value
Superfamily beta-Roll 6.67e-19
Family Serralysin-like metalloprotease, C-terminal domain 0.00078
Further Details:      
 
Domain Number 2 Region: 291-440
Classification Level Classification E-value
Superfamily beta-Roll 3.79e-17
Family Serralysin-like metalloprotease, C-terminal domain 0.00077
Further Details:      
 
Domain Number 3 Region: 89-211
Classification Level Classification E-value
Superfamily beta-Roll 1.44e-16
Family Serralysin-like metalloprotease, C-terminal domain 0.0012
Further Details:      
 
Domain Number 4 Region: 25-113
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000000249
Family Serralysin-like metalloprotease, C-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427728901|ref|YP_007075138.1|
Sequence length 458
Comment putative calcium-binding protein [Nostoc sp. PCC 7524]
Sequence
MANITGTQYNDNNSFQYVNGVLVYLPSLVGTALDDYISGLAGNDILYGNDGNDTLNGGTG
ADTMYGGTGNDNYYVDNLGDVVTEYAFQGTDTVYSSISYTLGANVENLTLIGTAYGGYGN
SLNNVISGNDSNNYLFGSSGNDTLYGNGGNDTLSGGTGADTMYGGTGNDNYYVDNAGDVV
IEYASQGTDRVYSSISYTLGSNVENLTLTGTAYGGYGNSLNNVISGNSSNNYLFGNSGND
TLYGNDGNDTLSGGTGADTMYGGTGNDNYYVDNAGDVVIEYASQGTDRVYSSIFSYTLGS
NVENLTLTGSAERGYGNSLNNVISGNSSNNYLYGNGGNDTLIGGGGNDYLNGFGSGQEYD
LLTGGLGADTFAVGSGNGVQYTGLGYATITDFSRAEGDKIQLLYLPDNNQYSLGSGNWGG
SSALDTGIFYNGDLIGVVRDTTTVSLQQDFTFVSLAVG
Download sequence
Identical sequences K9QQV1
gi|427728901|ref|YP_007075138.1| WP_015137993.1.5551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]