SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427729223|ref|YP_007075460.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427729223|ref|YP_007075460.1|
Domain Number - Region: 183-214
Classification Level Classification E-value
Superfamily PKD domain 0.00589
Family PKD domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427729223|ref|YP_007075460.1|
Sequence length 263
Comment PEP-CTERM putative exosortase interaction domain-containing protein [Nostoc sp. PCC 7524]
Sequence
MRNAIKFIGVLSWGGLLISSPAQAADLDFNNATSPWSTFGDVFVADPKEVLLSTDAILDD
DIQLGAISGQFNFSGQPAGEVGFVSPNLAEFLGIDVGLLDINGFAYEGSAIKRTIDVKAG
DSLIFQRNFLTNENSDLVSGTLRGSLNDYSFLLVNDQIKKLADINDATQSLPNFIVAFDK
ETGIQTVKHTFNNAGTYTIAFGVLDIDDYTVSSALSIQNVTLESSPISETIPEPTTILGA
LVTMGFGVLSRKNQWMKTNKNQV
Download sequence
Identical sequences K9QR56
gi|427729223|ref|YP_007075460.1| WP_015138311.1.5551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]