SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427729242|ref|YP_007075479.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427729242|ref|YP_007075479.1|
Domain Number 1 Region: 12-430
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.01e-57
Family Integrin alpha N-terminal domain 0.0006
Further Details:      
 
Domain Number 2 Region: 823-1203
Classification Level Classification E-value
Superfamily Pectin lyase-like 8.79e-31
Family Galacturonase 0.048
Further Details:      
 
Domain Number 3 Region: 499-813
Classification Level Classification E-value
Superfamily Pectin lyase-like 6.91e-18
Family Galacturonase 0.076
Further Details:      
 
Domain Number 4 Region: 1209-1335
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000549
Family CalX-beta domain 0.0036
Further Details:      
 
Domain Number 5 Region: 1479-1593
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000183
Family CalX-beta domain 0.0079
Further Details:      
 
Domain Number 6 Region: 1336-1465
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000249
Family CalX-beta domain 0.016
Further Details:      
 
Domain Number 7 Region: 428-501
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.00000000102
Family Integrin alpha N-terminal domain 0.007
Further Details:      
 
Domain Number 8 Region: 1595-1665
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.00000968
Family Integrin alpha N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427729242|ref|YP_007075479.1|
Sequence length 1676
Comment FG-GAP repeat-containing protein [Nostoc sp. PCC 7524]
Sequence
MTLLSFNLSELDGTNGFIINGIRAQDLLGVVSDAGDINGDGIDDVIVGAQGADVNGDSSG
QSYVIFGQQGGFSPSLNLADLNGSNGFALNGINLFDLSGTPVSGAGDVNGDGIDDLIIGA
SRAGVNGLPSGQAYVVFGQQGGFSPSLNLADLNGSNGFTLNNNVAGYELNSVSDAGDING
DGIDDVIVGTSPFSTNPGRAYVVYGQQEGFSPSLNLADLNGSNGFVLNSINLNESVALSV
SAAGDINGDGIDDLVIGAQRFGSSRTGQIYVVFGNQAGFSSSFDLSRLNGSNGFILNGTD
GDRLSLVSDAGDINGDGIDDLIVGAFGAVSNGVASGQTYVVFGRREQFSPSFNLSNLNGS
NGFAINGIGSSDLSGIAISGAGDVNGDGIDDLIIGAPFADPNGAFSGQSYVVYGREGGFA
PSLNLADLNGGNGFALNGINSEDVSGASVSGAGDINGDGIDDLIIGAPYADPNGDFSGQS
YVVYGRRGGFIPLVDTLVDENDGDLTPGDVSLREAISIAGNGATIAFSSTLNGGAIALTL
GELEITNNITINGLGENNLTISGSNESQIFRIAGNAEVNIDGLTITNGFSDTNGGAIDNR
GVLNLSNTTVRNSFTTADGGGINNLGTLNLLNTTLSNNTAGINGGAITNRGTITATNSIV
STNIALNNGGGIFNLNGTLQLVSNTITNNIVNSGNGGGIYSLIGQTTVNNTIIASNFDQG
GESPDVNGLFTSNGYNLIGINDGSIGFVNGVNGNIVGTRTNPINPLLGSLENNHVPSIIG
PAFDSGDPSLTGSDRLGTSRPQANGIDIGAVEFKLLDTVTVDNLTDEFDGDLSSGDVSLR
EALFIAAAGGNINFAQSLTGGTISLTLGTLNLNRNITIQGLGANNLTVDGNNTFSIFSIN
NNANTNISGLTLVNADNTAIVNNGTLILSDSIVRNSRGRFAGGIENQGNLTVINSKINNN
IEEEGEGGGGIFNQGNTTLIDTTISNNSSGGILNNSSFILINSTVSNNNGRGIRNSGTLN
LYNATISGNQSTNSGGGIINTGTLRVTNSTITNNSASQGGGIVNSGTAILGNTIVAGNNI
IDGNVNLVNHFDVEGNFISNGNNLIGSNEGSTGFINTNNGDIVGTNTNPINPRLGTLQDN
GGATFTHALLDDSIAINSGNNANLPEDIADLDGDNNISEPLPVDQRGVTRAQNGYVDIGA
FESNIETRSIVSFQVIDSQANEKGGNFGRYTLTRTASREGLTALTVNFSLDGGNTATFSD
DYNLLVNGTVINSINDNLSITFAQGQSQLNIDLIPVDDILLEDAETITINLNQAIEYAVD
PNNNSGTVTIDPSDPLSIVTIQATDSQANERGGDLGRYTLTRTPSDGELRELTINLSLDA
GNTATLTNDYNLEVNGEVITPINNNFNITFAEGQSELNIDLIPVNEFVNEDAETITLNLN
QSSEYAVDPNNNSGTVTIAPSDPLSIVAIRAIDSRSFERGGDIGRYSLTRTDSEGELREL
TVNISLDPGNTATFGDDYILEVNRRFITPVNGNFSITFAQGQSQLNIDLFGVDDLITEDA
ETITLNINEALGYAVDPINNSATVTMAASEQPIPQNHPLSTVDVGFYSVPTFIDENNDGD
LDLFIGALDGTIAVAHNQGRAAIPNFANPIIIRDVGNRSTPTFADIATEVTAASCP
Download sequence
Identical sequences K9QSW9
gi|427729242|ref|YP_007075479.1| WP_015138329.1.5551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]