SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427729317|ref|YP_007075554.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427729317|ref|YP_007075554.1|
Domain Number 1 Region: 297-606
Classification Level Classification E-value
Superfamily Pectin lyase-like 9.11e-20
Family Pectate transeliminase 0.049
Further Details:      
 
Domain Number 2 Region: 793-958
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.55e-17
Family Galacturonase 0.022
Further Details:      
 
Domain Number 3 Region: 620-799
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000000014
Family Galacturonase 0.027
Further Details:      
 
Domain Number 4 Region: 1208-1403
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000204
Family Pectate lyase-like 0.097
Further Details:      
 
Weak hits

Sequence:  gi|427729317|ref|YP_007075554.1|
Domain Number - Region: 1045-1201
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000434
Family Galacturonase 0.085
Further Details:      
 
Domain Number - Region: 957-1038
Classification Level Classification E-value
Superfamily L domain-like 0.00782
Family Internalin LRR domain 0.054
Further Details:      
 
Domain Number - Region: 1421-1471
Classification Level Classification E-value
Superfamily DNA terminal protein 0.0785
Family DNA terminal protein 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427729317|ref|YP_007075554.1|
Sequence length 1505
Comment parallel beta-helix repeat (two copies) [Nostoc sp. PCC 7524]
Sequence
MNNLQYLGCITLLGVLASASTAMAQTPAPIFTPRLGVRYTTEGGGYESFSSFEGFLPVFQ
TPGNSLTFLQGKVLLDNDSNLGTNILLGHRIFSPEGNRVVGGYIAYSTRDTGKSNFNQLG
LGFETLGNWDFRFNAYLPLGSSENQVSVINTGSGFQGNSFLLGRQRSFEVAMSGVDAEFG
TRLLRLGAGDLRGFVGAYYYSGGESKEAFGWRTRVEARPTDFLNFGLSLQHDELFDTRLV
FTIGANFPGSSGRGTKPKKDSALLRMAESSDRQSAILVTHERRNDTVVATGTDNQPLTII
YVANNGTGNGTFESPLGSITNAVGIAKANNIIYVLADTPTIIAPFTIPDGVQVLSSASVQ
TVNTQQFGMVTLPLSGNGIYPVITGSVTAGNGLVALGNNTVLSGFDIQVQGSDDARGIKG
TNISNVRILDNKITNALSEGIYLENVTGIVEIARNTITDTRNSATDTSLESGIFVWNYQG
DTNLTITDNRIITNFNTEDYRIDGIEVNLCRDVDELFVSKTCASNASITATITNNEIIHN
GQISGGGDGIDINLGNLSKGTFTISNNTITNIPDEGISINAVANSEGNFIIANNIITNVG
DSSIEVDLFLPDHNISPAVNLFNNSRTQFVITGNTLDGTDNDGIDFAVADNADTTITIAN
NTIQNIGDGDSSDRGIQLAATNNAIIRSTITNNTITDVTGDGINLSQVTDATVTNNNLNN
ISSDGIEIDNASGNNNISSNTISNVSNDGIDLDNINNANVTNNNINNTGDDGIYIDDASG
NNNISSNIVSNVFDDGIELENVANANVTNNNISSAGDNGIEIDNASGNNNISSNTISNVS
DNGIELDDVNNANVTNNNISNTGDDGIDIEDASGNNNISSNTISDVSDDGIELDDVNNAS
VTNNNITRAGDKGIDIEDTQGTINVDSNTITDAQQESISLSEVTGTVSVSQNIVNGNNNN
NGIAIANTTGTTNLTVNSNQLTENFNDIRVSLSDTTGTLQINDNTITNNGTAIDVQLGAN
TNLTSVSLNNNQITGVDADVTSSGINFQAFDAAAGNVSVSGNTINTITNGDGMNFQLNGA
STATFQIANNIISNIRDTDTGDFNFTEAINFEIFDDAKADVTITHNNISQIPTGNGIYMQ
FGGGDNAGNIAITDNTISQITTEGNGIDLQFFDNFDTTNINAIVNVSGNIISDIQGTGIN
AFNETSDNTVNLTANNNSITNISGDGINLNGVNNAQVTNNNITNAGEQGIQVEKAHGTIN
VDSNTITDAQQESISLSEVTGTVSVSQNIVNGNNNNNGIAIANTTGTTNLTVNSNQLTEN
FNDIRVSLSGTSGTLQINDNTITNNGTAIDVQLGANTNLTSVSLNNNQITGVDASITSSG
INLQAFDNAAAGNVTASGNTINTITNGDGMNFQLNGTSTATFQIATNTISNIRDTDAGDF
NFTDGINFEIFDAAGSTVEVSNNVIDQIQGYGISVTNFSSGIVNVNINNDNQITNTQDGK
VFTTP
Download sequence
Identical sequences K9QT33
WP_015138403.1.5551 gi|427729317|ref|YP_007075554.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]