SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427729449|ref|YP_007075686.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427729449|ref|YP_007075686.1|
Domain Number 1 Region: 4-289
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.55e-34
Family Pectate transeliminase 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427729449|ref|YP_007075686.1|
Sequence length 694
Comment putative S-layer protein [Nostoc sp. PCC 7524]
Sequence
MVNTTPVAIVYVNPVTGNDTNIGSRPSPWKTITRALKVSPPAIIQLAPGTYSASSGEVFP
LVIPQGVTVVGNEANKGAGIVISGSGEYKSPSFGVQNVTILLLNNASLRGVTVTNPVAKG
TGIWIESTAPNLANNTLTKCGREGVFTSGTAKPTIIDNVFVQNAASGLFMARNSKGEVLR
NVWQNNPLGIAISDFAAPLVANNKLSENRTAIALSRNARPVLRQNLITKNTQGGLLVNEN
AIPDLGSSQDAAGNIFSNNGVFDLQNTTTQPLISVGNQLNPTQVKGLVDFLAAITDNPAQ
LANTRFIDLAGHWAGAFVEALINKGIISGFPDGTFAPNAPITRAQYAAVIAKAFNLPTNH
QPTQFKDVKSDFWAASAINQAAQMGFISGFPDATFRPGQNLTKVQAIVSVVNGLKLSGGS
PNALNIYRDRAQIPSYATNPVATATQNQLVVNYPHTDEIEPLRDITRAEVATLIYQALVA
SGQAQAIASPYIVSPEVDIPSFTDLAGHWAETFIRGLASMGITHGFADGSYQPNKPMTRA
QYAAMVAVAFNPPPRRPATDFTDVPKDFWAYQALQIAAAGGFVSGFSDRTFRPHQNVQRL
QVIVSLVNGLALPAVDSNSLLTYTDSNTIPEYARKAVATATQQKIVVNYPDPKQLIPTRE
ATRAEVAAMVYQALVAMQRAPSINSPYIISTPGS
Download sequence
Identical sequences K9QSM5
WP_015138534.1.5551 gi|427729449|ref|YP_007075686.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]