SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427729594|ref|YP_007075831.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427729594|ref|YP_007075831.1|
Domain Number 1 Region: 212-533
Classification Level Classification E-value
Superfamily Subtilisin-like 4.71e-66
Family Subtilases 0.000029
Further Details:      
 
Domain Number 2 Region: 546-659
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000000361
Family Proprotein convertase P-domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427729594|ref|YP_007075831.1|
Sequence length 662
Comment regulatory P domain of subtilisin-like proprotein convertases [Nostoc sp. PCC 7524]
Sequence
MVQVRYGGENGEQYELVISDNHIVVRTHNRSVLIGDRPFEVASVSPQAHNILNQFEVKVE
FHQAGVEILQAKVPSQDSVLRDQAREVLNQEPEIQFAGRVLVDPVSMEPVIYTENLFVKF
DDEAEVTTCHEVLGRYGLRIKRQLEYARNAYFVSAPENTGLAVFDIAERLLHEESVELCH
PELVREFRQRQAFPQQWHLKETTINSKTINAHANVEAAWKLSEGAGTTIAIVDDGVDIEH
EEFRSAGKIVAPRDVTRKTNDPRPGNWDHHGTACAGVACGNGNFGASGVAPKAKLMPIRF
VSALGSQDEADAFVWAAQNGADIISCSWGPPDGKWWDANDPAHNKKVPLPDSTRLAMDYA
INKGRNGKGCVILFAAGNGNESVDNDGYASYSKVMAIAACNDFGTRSAYSDFGNAVWCAF
PSNNGYSSQTPGIWTSDRTGLAGYNSGNITLGDQAGNYTNSFGGTSSACPGVAGVAALII
ARNPDLRWDEVRDIIKRSCDRIDVAGGNYNADGRSPFYGYGRVNALKAVELALPAQPEPV
GIFKVVQDVPINDLQTSQLSLAIANTKPIKSIKVEVDIEHTYIGDLVVSINPPQESGVLP
IILHNRQGGATDNIKKTYDEVNTPELTQLKEKSPQGNWTLEVADKAQVDTGKIRSLTIEI
GF
Download sequence
Identical sequences K9QT19
WP_015138676.1.5551 gi|427729594|ref|YP_007075831.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]