SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427729640|ref|YP_007075877.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427729640|ref|YP_007075877.1|
Domain Number 1 Region: 810-985
Classification Level Classification E-value
Superfamily beta-Roll 4.58e-20
Family Serralysin-like metalloprotease, C-terminal domain 0.00094
Further Details:      
 
Domain Number 2 Region: 718-814
Classification Level Classification E-value
Superfamily beta-Roll 1.57e-17
Family Serralysin-like metalloprotease, C-terminal domain 0.00082
Further Details:      
 
Domain Number 3 Region: 631-709
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000000106
Family Serralysin-like metalloprotease, C-terminal domain 0.001
Further Details:      
 
Domain Number 4 Region: 481-582
Classification Level Classification E-value
Superfamily CalX-like 0.0000034
Family CalX-beta domain 0.01
Further Details:      
 
Weak hits

Sequence:  gi|427729640|ref|YP_007075877.1|
Domain Number - Region: 370-473
Classification Level Classification E-value
Superfamily CalX-like 0.0209
Family CalX-beta domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427729640|ref|YP_007075877.1|
Sequence length 992
Comment putative extracellular nuclease [Nostoc sp. PCC 7524]
Sequence
MADFVVNQATDDGTGSQANTLSWAILQANQLAGDDTITLANNVRVTGVMKTLINSNITIV
GNGNSISGDANNNGVTDVGDVRPLFILSGTVNISNLTITNGMAKGGDSRRGGGGAGMGGG
LFIYDGSVSLTNVTFSNNKALGGTGSGGSGFGGAGMFGNSVSYGGGGLFGNSSNDFGGYG
GNGNYGGGGNGGFGGGGNYRNSGGFGGGGGGAGHTGGNGGFGAGGGYGGYVGGAGGYGGG
GGSSREGAGGTIGGFGGGNGLNGGGTSSNGGGGAGMGGGIFMRSGSLTLNNTTFNNNTAT
GGTGFNNGKGLGGGIFIMQSTTNTNGNNQSMPSTLPTVSSTGTTFNGNLAADDTATNNVY
TLVKITHTGGSTNVTEGGATDTYTVVLNVLQPTADVIITINTDSQLTTSPTILTFTPQNW
NVPQTVTVTAVDDLTIEGNHSGSITYTVASTDSNYNSITSSPLNVAITDNDNAGVTITPS
GRSTDVTEGGATDTYTVVLNGQPTSNVTININTGSQLTTSPTTLTFTPQNWNIAQVVTVT
AVDDTVAEGNHSGTIQHTATSSDSNYNGISITSVNVSITDNDSINPPTQGTSGKDILRGT
NNDDTINGLDGNDYIFGGDGNDTLDGGTGTDYVFGGEGDDSVSGGDGNDFLYGGAGNDTL
NGGEGGDNLDGGAGDDTLAGGIGNDIYTVDSINDQVIELEGEGTDKINSSITWDLNNSAN
VENLTLIGTAIDGTGNALNNHIVGNNAVNTLHGGDGNDWLMGRGGDDILIGGNGNDRLDG
GTGDDRLEGGLGNDIYEVDSGLDEIIEAPDAGIDTVISVIDWNLGDNLENLTLVGNQAMF
GIGNDADNRINGNNADNFLLGLDGDDQLSGGNGDDVLIGGLGFDRLVGGRGADIFDLTGV
LFGGFDTVVDFNLADDIIHLSGDEFGLSAGTTLDASLFSLGIDATQASDRFIYNQAKGEL
FYDADGVGGANQVQIALFSNRVALTNASFQVV
Download sequence
Identical sequences K9QRN0
gi|427729640|ref|YP_007075877.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]