SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427729674|ref|YP_007075911.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427729674|ref|YP_007075911.1|
Domain Number 1 Region: 748-876
Classification Level Classification E-value
Superfamily beta-Roll 3.79e-23
Family Serralysin-like metalloprotease, C-terminal domain 0.00057
Further Details:      
 
Domain Number 2 Region: 503-555,582-616,673-733
Classification Level Classification E-value
Superfamily beta-Roll 4.03e-21
Family Serralysin-like metalloprotease, C-terminal domain 0.0023
Further Details:      
 
Domain Number 3 Region: 208-349
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.000000000342
Family Serralysin-like metalloprotease, catalytic (N-terminal) domain 0.035
Further Details:      
 
Weak hits

Sequence:  gi|427729674|ref|YP_007075911.1|
Domain Number - Region: 382-478
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000107
Family Collagen-binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427729674|ref|YP_007075911.1|
Sequence length 932
Comment Ca2+-binding protein, RTX toxin [Nostoc sp. PCC 7524]
Sequence
MKSFRSVAKNLTKRQFPWKKSDFQDLSANFPENEGLVDDSGWRLNPQTGKDPQMQTSAMD
NDASISDEGAVFAESLLTKSFTAAVLKSVQLTVSKTSDAVILSTNSHTIGCACSVCALPP
VEPELIQNEQQTLTASATTSTTASATLDLSKTFFLNSLAGARHTIYLDFDGHTTSGTGWN
ASYAGGANIVTPAFDFDGNPASFSSAELERIQYIWQRVAEDFSPFNVNVTTQAPTDINDL
IKSSSSDTRWGVRVVIGGSSSSWFGSSAGGVAYRGSFNWNTDTPTYVFSDSLGDNEKYVA
EAITHEVGHTLGLSHDGRTSPAEGYYRGHGSGQTGWAPIMGTGYYQNLTQWSKGEYGSAN
NTQDDLQIITTNNGFSYRADDTGNTIATAKALTISGTTLIGSGIIERNTDIDYYRFAASA
GSITITVNPFTRGPNLDIWAGLYNSGGTLIASSNPTDLLSASITTSVAAGTYYLAIDGVG
KGDPLSTGYTDYGSLGQYSIEIATNEILYGSADDDTLIGSADDSILMGGLGDDTYIVDTT
TYTIIENAGEGIDTIESSVTFSLATLPNIENLTLIGTAAINGTGNAANNVITGNSANNIL
DGGAGNDTLIGGLGHDTYIVNSTTDTIIENPGEGTDTISSSVTFSLAALPNIEKLTLTGT
SAINGTGNGANNTITGNNGNNRLDGGAGNDTLNGGAGIDTLIGGLGNDVYSVNTTTDTII
ENAGEGTDRVSSSVTFSLAALPNIENLTLTGTTAINGTGNGADNIITGNSGNNSLDGGAG
NDTLNGGTGNDTINGDAGNDILTGGTGKDTLTGGLGVDRFDYRKLADSLLSNFDVITDFN
ANAGNDLFFVSTARAGFYDGGTVATLDATDIAAQLTTANFAANFAALFTFGSRSFVAINN
ATAGFSATTDAIIEVTGFTGTLGIDNFTTTSV
Download sequence
Identical sequences K9QT96
gi|427729674|ref|YP_007075911.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]