SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427729770|ref|YP_007076007.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427729770|ref|YP_007076007.1|
Domain Number 1 Region: 332-545
Classification Level Classification E-value
Superfamily beta-Roll 7.85e-41
Family Serralysin-like metalloprotease, C-terminal domain 0.00024
Further Details:      
 
Domain Number 2 Region: 199-327
Classification Level Classification E-value
Superfamily beta-Roll 6.15e-26
Family Serralysin-like metalloprotease, C-terminal domain 0.00044
Further Details:      
 
Domain Number 3 Region: 3-178
Classification Level Classification E-value
Superfamily beta-Roll 8.97e-21
Family Serralysin-like metalloprotease, C-terminal domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427729770|ref|YP_007076007.1|
Sequence length 564
Comment putative calcium-binding protein [Nostoc sp. PCC 7524]
Sequence
MPYIPGSNQNDYLQGTAGDDLIETFAGNDTVNVAITIREFVANGQLIRVPIYEPDDDGSG
NDTIWGGIGSDALSGGIGNDSVNGEADNDTLWGGIGNDTVNGGDGNDIINAHQEYVVFRY
EGQDYLDSYLVFDEDPGDDFFYGGNGDDFIYAGNGRDYIDGGAGLDVLYLNTTAYTSNLT
VSFTNAANPGTVSTGTQFTGIEYISVTTGNGHDTINLSAFVTGTEVNSGAGNDLITGGTG
GDYLYGDAGNDTINGGDGNDSLNGGSGNDSLDGGAGNDTLIGGAGNDTLNGGSGIDTASY
QTATAAVNVNFSTGTATDGQGGTDTLISIERVIGSKFNDTLIGGVGNDSLNGGAGNDTLN
GGTGNDTASYQNATAAVNVNLSTGITTDGQGGTDTLISIERVIGSKFNDTLIGGSGNETL
EGGSGNDTLNGGSGNDILIGNSGNDSLIGGTGNDTLTGGTGADRFIFNSLTQGIDNITDF
NVVDDTIAVSAVGFGGGLVAGAAIAASQFVLGTAATTSNHRFIYDQTSGALFFDQDGTGV
SAQVQIATLNIGLALTNADIFVNA
Download sequence
Identical sequences K9QS25
WP_015138848.1.5551 gi|427729770|ref|YP_007076007.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]