SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427730016|ref|YP_007076253.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427730016|ref|YP_007076253.1|
Domain Number 1 Region: 8-349,1011-1259
Classification Level Classification E-value
Superfamily beta and beta-prime subunits of DNA dependent RNA-polymerase 2.98e-200
Family RNA-polymerase beta-prime 0.0000000608
Further Details:      
 
Weak hits

Sequence:  gi|427730016|ref|YP_007076253.1|
Domain Number - Region: 464-681
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0314
Family Pectate lyase-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427730016|ref|YP_007076253.1|
Sequence length 1348
Comment DNA-directed RNA polymerase, beta'''' subunit [Nostoc sp. PCC 7524]
Sequence
MTNEKMIFRNRIVDKGQLRNLISWAFTHYGTARTAVMADKLKDLGFRYATRAGVSISVDD
LMVPPTKRSLLESAEEEIRATEARYQRGEITEVERFQKVIDTWNGTSEALKDEVVTHFKQ
TNPLNSVYMMAFSGARGNISQVRQLVGMRGLMADPQGEIIDLPIKTNFREGLTVTEYIIS
SYGARKGLVDTALRTADSGYLTRRLVDVSQDVIIREIDCGTTRGIPLRAMTEGSKTLIKL
STRLLGRVVGEDVIHPTTKEVIAPRNTPISDDLAKEIEKAGVTEVVVRSPLTCEAARSVC
QHCYGWSLAHAKMVDLGEAVGIIAAQSIGEPGTQLTMRTFHTGGVFTGEVAQQVRSKIDG
TVKLPRKLRTRPHRTRHGEDALYVESNGTLILEPRKDGAETPVPQEINVTQGSTLYIVDG
QQVKVGQLLAEVALGGRTTRANTEKAVKDVASDLAGEVKFAEVVPEQKTDRQGNTTTTAA
RGGLIWILSGEVYNLPPGAELVVKNGDSVATNGVLAETKLTTLHGGVVRLPEATPGKSTR
EIEIITASVVLDQATVTVQSSQGRNNYLITTGNNQVFNLRTTPGTKVQNGQVVAELIDDR
YRTTTGGLLKFAGVEVQKKGKAKLGYEVVQGGTLLWIPEETHEVNKDISLLLVEDGQYVE
AGTEVVKDIFCQNNGVVEVTQKNDILREVVVKPGELLMVDDPEAVIGKDDTILPAGEELL
GRVFNELRYIQYVESPEGPALLSRPVVEFAVPTNPDVPSTTSVSQQTGRSIQMRAVQRLP
YKDSERVKSVEGVELLRTQLVLEIEQEGEQEHNASPLAADIELVPDAENPDIQRLQLVIL
ESLVIRRDIAADATQGSTQTSLEVKDGDTIAPGAVVARTQILSKEGGIVRGVQKGTEAVR
RCLVLRHNDMVTLNATAQPTVKAGDLIVAGAAIAPGVFAEESGQVVSVKNANAASAGSES
ALSVQNYSVTIRVGRPYRVSPGAVLQIEDGDLVQRGDNLVLLVFERAKTGDIIQGLPRIE
ELLEARKPKEACILTKRGGEVKVVYGDGDEAIAIKVVESNGVVTDYPLGPGQNLIVPDGY
HVSAGQPVTDGPSNPHEILEIFFSLGSEEGVYACASHALQKVQTFLVNEVQMVYQSQGID
IADKHIEVIVRQMTNKVRIDDGGDTTMLPGELVELRQVEQVNEAMAITGGARAQYTPVLL
GITKASLNTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTGYNTYD
EPGMIEDYATLDTTSVLDETDDPLDMVLDDRTARAYNLDAPTLTESGFGNRRSILDDDEL
IADEVHDLVDEDEGDDYEEDDEDDYDDD
Download sequence
Identical sequences K9QU10
gi|427730016|ref|YP_007076253.1| WP_015139094.1.5551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]