SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427730037|ref|YP_007076274.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427730037|ref|YP_007076274.1|
Domain Number 1 Region: 960-1176
Classification Level Classification E-value
Superfamily beta-Roll 3.79e-27
Family Serralysin-like metalloprotease, C-terminal domain 0.00069
Further Details:      
 
Domain Number 2 Region: 843-1008
Classification Level Classification E-value
Superfamily beta-Roll 1.83e-21
Family Serralysin-like metalloprotease, C-terminal domain 0.0013
Further Details:      
 
Domain Number 3 Region: 771-889
Classification Level Classification E-value
Superfamily beta-Roll 3.79e-21
Family Serralysin-like metalloprotease, C-terminal domain 0.00068
Further Details:      
 
Domain Number 4 Region: 670-753
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000000129
Family Serralysin-like metalloprotease, C-terminal domain 0.001
Further Details:      
 
Domain Number 5 Region: 260-532
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.00000000000124
Family Tricorn protease N-terminal domain 0.027
Further Details:      
 
Domain Number 6 Region: 546-663
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.0000188
Family DPP6 N-terminal domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427730037|ref|YP_007076274.1|
Sequence length 1183
Comment Ca2+-binding protein, RTX toxin [Nostoc sp. PCC 7524]
Sequence
MFTTNNSNDKLSQAVTEGSTNRGILFMDGAVENYSSLVTGVLPGFEVIILDSTQDGVEQI
TQVLSQRQGIDSVHIVSHGSCGSVQLGTANLSWDTLSFYASQLQSWQNALTDAAQILLYG
CNVAAGAVGKAFVQRLSELTSSVVAASDDLTGNAALGGDWELEVQTGCDAVTLAFSQASI
EAYEGVLNSQPYLVTDINLGNFFSPNYLTNVNGTLYFEAYTPTYGRELYRLDNTTGNAVR
LTDINPGARNSSPYNLTNINGTLYFVAENRTYGRELYRLDNTTGNAVRLIDINPGAGSSR
PEALRYINGTLYFEAYTSTYGRELYRLDNTTGNAVRITDINPGAGDSNPYELTEINGVLY
FRAYTSTYIYDLYRLDNTTGKAVRVTDSNTGDGLSFSQELTNINGTLYFTAVNTLDSYRN
FKLYRIDNTTGNAVVIDINAGANSSDPYRLTNINGTLYFTTSYGIYRIDNSTGNPVPVTD
NNFGNVSAAPYQLIYINGTVYFRAYNFTYGHELYRVDNSTGKAVLVTDINPGVESSHPDT
LTNINGTLYFTASTPTFGRELYRVDNSTGKAVLVTDINPGVESSHIDNLTNINGTLYFTA
STPTFGRELYRVDNSTGKAVRITDINPGAGDSYPGYLTYFNGILYFRASDSTLAYQLWAL
PIEAANQNEITGTSASETLNGTANPDIIYALEGDDKLYGFVGNDTLYGGTGNDWLDGGAG
ADEMIGGSGNDIYFVDNPQDTIIEDANGGIDAVISTISWELGNHLENLTLTGNNTINGTG
NSGNNVLIGNSAANILSGGDGNDWLSGGAGNDTLYGETGNDTLYGGTGNDWLDGGAGADE
KIGGSGNDIYFVDNPQDTIIEEANGGIDAVISSISWQLGNHLENLTLTGSNAINGTGNGG
NNVIIGNSAANILSGENGNDWLSGLGGNDRLLGGNGNDTLDGGTGDDWLDGGAGADEMIG
GSGNDIYFVDNPQDTIVEYANGGTDAVISSISWQLGNHLENLTLTGSNAINGTGNGGNNV
IIGNSAANILSGENGNDWLSGLGGNDRLVGGHGNDTLDGGTGDDTLIGGRGLDDLIGGAG
KDSFQLSLPVVGDFDTIADFSVADDKILISKAEFGLTQALGVLDASVFRLGTSAVTAGDR
FIYDQSTGNLFFDTDGLGGNTQVQIARLSNQAVLNNTHITVIA
Download sequence
Identical sequences K9QV50
WP_015139115.1.5551 gi|427730037|ref|YP_007076274.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]