SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427730138|ref|YP_007076375.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427730138|ref|YP_007076375.1|
Domain Number 1 Region: 802-1167
Classification Level Classification E-value
Superfamily Thermostable phytase (3-phytase) 9.15e-70
Family Thermostable phytase (3-phytase) 0.000000341
Further Details:      
 
Domain Number 2 Region: 39-157,193-305,336-403
Classification Level Classification E-value
Superfamily DNase I-like 1.18e-18
Family Sphingomyelin phosphodiesterase-like 0.072
Further Details:      
 
Domain Number 3 Region: 474-708,794-852,1040-1082
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.0000000418
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427730138|ref|YP_007076375.1|
Sequence length 1515
Comment 3-phytase (myo-inositol-hexaphosphate 3-phosphohydrolase) [Nostoc sp. PCC 7524]
Sequence
MTTLRFSQFNASLNRGAAGQLVSDLTNVDNPNNDTATQARINQAKTVAEIIQRNNPDILL
INEFDYAPEAVDLFKQNFLEVSQNGATPVTYQYAYIAPSNTGIASGFDLNNDGTVGGGND
AFGFGNFPGQFGMLLLSKYEIDTENVRTFQNFLWKDMPGSLLTDDPTVDNPNTPASENLN
GFYSPEEIEILRLSSKSHWDVPIKVNGETVHVLVSHPTPPLFDDPANTPPDQIIDWNGKR
NHDEIRFWADYVTPGKGDYIYDDNQKTGGLAAGSRFVIMGDQNADPNDGDSYNNAILQLL
QNPGINTNSIPSSPGAAQQASSQGIANNNHKSNPSFDTADFNDNAPGNLRADYVLPSVDL
QITNSGVFWPLNTDPTFPLVGTFTSGIPGGFPSSDHRLVFADVQMGATEKGASLPEVEFE
GETTFVTGFVPGGAAGTEAVGGLSGVVYDAGNQVYYALSDARSDASTGGSVRFYTFTADL
TDITNPQVSFTDVTTLTDAEGDAFAPFSLDPEGFALTNNGTVFVSSEGEASANRVIDPLI
KEFNLSTGQEIRSLPVPEKFKPVFNDFNNNGVLDAGEQTSGVRNNLAFESLTITPDQKTL
YTATESALTQDGAIATTQTGARARIIQYNLASGQPEKEYLYMVDPVAEASSPANAFTVSG
LVDLLAIDNRGTFLALERSFSVGAPGTGNTIKIYEVSLQGATDISTIDSLAGDITGIQAV
QKRLLLNLNELNLPNGLDNIEGLAFGPKLADGRQSIVLVSDNNFNAIQFTQILTLSADLV
PTATPRVETRPDLLDDETLPTDQQADADDPAIYLHPTDSARSLVLTAVKNAGLRVYDLSG
NLLQTINPGGIRYNNIDLQYGFILGGQKIDIAVASDRRNDKLAIFKINPDATGNNYLEDI
TDTSIGAIFTQPTFPNSIEDESHAYGLALYRSPITNDYYVFVNRRNTGDVAQLKLVDNGS
GKISTEFVRGFTVTPPPEIVDAELQTEGMVVDQETGYLYIGQENVGLWKFEAEPTGNNQG
KLIDRIKEFGGSNLVDDVEGLSIYYGADGKGYLLVSSQGDNTFAVYRREGDNEFIGRFAV
GNNGSIDSVQESDGADVINVPLGANFPFGLFVTQDGNNDPEVLVEDEGELENINSNFKFV
PWENIANSFPEALAIDITSYDPRNPVNRIAAQIKILPALNQVADDIFQITGGENLKLKVT
VLGRNSQLVNELGVFTVDDTNGTIDGIAPGAVGYTNAALARSKVIFSAIANNPNGFNPAN
LVRLLEFNENNNLRFYLIKNSSKDAVNTGTISSDNIIFSSNSTQKITNLGTEGFSLGWTE
GSSSEFNDLEVKIKAVDESFPLGTNLQGQSQGEVIDLLGVTGSITANFIVNREAAFNNFV
GFYKVANINGGIDTNNDGVADILPGQSGYIQAAVENRIAGIDLTVNNQGTATYTGRFQGG
SIFAPFIIIDGRPDALLDSNTTNDPAVYFPYLGANADNFDHIRLLGDNVFGFEDLPNGGD
QDFNDVIVQVNLSVV
Download sequence
Identical sequences K9QTP5
gi|427730138|ref|YP_007076375.1| WP_015139213.1.5551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]