SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427730291|ref|YP_007076528.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427730291|ref|YP_007076528.1|
Domain Number 1 Region: 298-394
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000169
Family Pentraxin (pentaxin) 0.07
Further Details:      
 
Domain Number 2 Region: 178-224
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000056
Family Laminin G-like module 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427730291|ref|YP_007076528.1|
Sequence length 494
Comment glycopeptide antibiotics resistance protein [Nostoc sp. PCC 7524]
Sequence
MTRNNKLRQKYNWLLCLISILAVLLATLYPFDFSGFDSFSLSKIIISFKNASSFQDQVNN
ILLFMPLGFSLASGLQNLNIKKIRQILIVILASFSLSLTVEFSQIFLPSRMPTPADLINN
TLGGFLGLICFQIWHNPSFSSTVKQIENSRVSQSIQKIIGFCVGYIILAVLISFLWQTTT
TLSNWDINYPLIIGNERTGDKPWQGYVSELQIADRAISISEVGKILDEPGYFEKFGDSLL
ANYQLTGKCCYQDQTGKLPKLIWKGNPKNQQESKGVFLSAEHWLQTSTPVTYLSNRISQT
SEFTISTTVATANLEQNGPARILSVSGNSLRRNWTLGQQGNSLDFRLRTPITGENGTELN
LHIPNIFLDTKPHHLVITYSRATIQVYVDQLQNAYSFNLIELIPQQQRVFYYALTFIPLG
IGLAILSLLAKGRLIFSQVVLYSGILIPSLILEGILVSESGKTFNLKHLLLGITFTAGTI
LVLKVRASQLKMRS
Download sequence
Identical sequences K9QUV1
WP_015139366.1.5551 gi|427730291|ref|YP_007076528.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]