SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427730336|ref|YP_007076573.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427730336|ref|YP_007076573.1|
Domain Number 1 Region: 3-185
Classification Level Classification E-value
Superfamily beta-Roll 5.91e-21
Family Serralysin-like metalloprotease, C-terminal domain 0.0013
Further Details:      
 
Domain Number 2 Region: 280-324,363-465,495-571
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 0.000000000000379
Family Purple acid phosphatase-like 0.037
Further Details:      
 
Domain Number 3 Region: 216-273
Classification Level Classification E-value
Superfamily Purple acid phosphatase, N-terminal domain 0.0000144
Family Purple acid phosphatase, N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427730336|ref|YP_007076573.1|
Sequence length 1091
Comment phosphodiesterase/alkaline phosphatase D [Nostoc sp. PCC 7524]
Sequence
MTTINGTAGKDELLATGSGQTLLGLEDNDIIDGVTGLGNNTLDGGVGDDEIFAKTDDLAL
GGQGNDFLYSDGNGNNNLSGGDGDDEIFPDRNDRVFGDAGNDVIYAGLGGNTFTGGAGED
IFWLANVEFLEIPNIITDFNPSEDELLVDVDGIKQLSGLTFTKQQNDTLISANGRELAII
QNNILGLANGIASGDTTQTSSVLWARSTFLGQVTFEYSTDRNFNTIAGVKTATVTNINVP
VKVDISGLNPGTKYYYRVTDAVGVSAVGQFQTAATLGSRTGLRFGVAGDWRGELAPYPAI
SNVPERDLAFFVAHGDTIYADVGSDAVLNPDGSRKSQAETIDEYRAKHNEVYSTRLGRNT
WADLRASTAILATIDDNEVINDFAGGADASTDPRFGVSSGFINDTPLYENGLQAFQEYNP
LRDEFYGNVGSDRFNNERKLYRYNTYGSDAAVFVLDGRSFRDKALQPPSDINNPNEINRV
LNESLTQNRTLLGSVQLADLKRDLLAAQAGGITWKFVMTPQPIQNIFPGVAVDSYEGYGK
ERTELLRFIQENNIDNVVFVAADVHGTFVNNLTYQEQPQGTQIATRAWEITTGAVAFDPP
TGKLLAERFWLNDAAQRNLYNSLPIAPDLDDQPNDQDDFVKQAINNNLAALGFDPLGLNQ
NLSQAEGLINATLLEGDYFVGHTYGWTEFDVNPTTQALTVTTYGINSYSEEELNINTIPN
LSPKVVSKFVVNPQFRNPLPPPRPPLVPLEFNNNNILNVSADSNLKIQLTGVRANTVNEV
GFFVVRDDVGTITDVNGNLLTPGAGDAYIQAALRQSQVLLSAITNLPNGFSNANSNRIIN
TKAGDRLVFYLINNGTTDGVVRGRIPASRVTLGSNFGSGNLSQLQTTSLGDNKWSLAWGG
EQMVLSLERTPISPVIGTKLQIANPSELIDLRDVSGLVNADFSIFREAAFNNEVYFYNVN
NVDGLIGNINPNTSSVRDYIQAALNNLVRDALTGEVVRFAVANQGTQTGKATIAGGSILA
PMIIVNGTRSQLTDSNPNNDPQVYFPYLGVNSDGVDHIRLLGDNTFGFEDLPNGGDLDYN
DIIVKINFSGV
Download sequence
Identical sequences K9QUZ5
WP_015139411.1.5551 gi|427730336|ref|YP_007076573.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]