SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427730416|ref|YP_007076653.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427730416|ref|YP_007076653.1|
Domain Number 1 Region: 1006-1219
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.81e-24
Family Beta-D-xylosidase C-terminal domain-like 0.084
Further Details:      
 
Domain Number 2 Region: 4080-4316
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 1.11e-18
Family Tricorn protease domain 2 0.038
Further Details:      
 
Domain Number 3 Region: 10501-10586
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000000196
Family PKD domain 0.0015
Further Details:      
 
Domain Number 4 Region: 10417-10501
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000000051
Family PKD domain 0.0026
Further Details:      
 
Domain Number 5 Region: 10590-10663
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000000131
Family CalX-beta domain 0.0031
Further Details:      
 
Domain Number 6 Region: 4750-4833
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000157
Family Cadherin 0.013
Further Details:      
 
Domain Number 7 Region: 1260-1354
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000681
Family Cadherin 0.0054
Further Details:      
 
Domain Number 8 Region: 5343-5426
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000188
Family Cadherin 0.037
Further Details:      
 
Domain Number 9 Region: 6739-6876,7039-7143
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000000000235
Family YVTN repeat 0.016
Further Details:      
 
Domain Number 10 Region: 4556-4644
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000104
Family Cadherin 0.051
Further Details:      
 
Domain Number 11 Region: 5253-5341
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000228
Family Cadherin 0.024
Further Details:      
 
Domain Number 12 Region: 1365-1449
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000428
Family Cadherin 0.01
Further Details:      
 
Domain Number 13 Region: 1465-1541
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000106
Family Cadherin 0.0073
Further Details:      
 
Domain Number 14 Region: 4655-4736
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000204
Family Cadherin 0.042
Further Details:      
 
Domain Number 15 Region: 5165-5249
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000366
Family Cadherin 0.027
Further Details:      
 
Domain Number 16 Region: 4835-4947
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000137
Family Cadherin 0.025
Further Details:      
 
Domain Number 17 Region: 3901-3996
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000769
Family Fibronectin type III 0.0046
Further Details:      
 
Domain Number 18 Region: 9708-9822,9860-9888
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000103
Family Matrix metalloproteases, catalytic domain 0.049
Further Details:      
 
Domain Number 19 Region: 6255-6324
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0000942
Family Invasin/intimin cell-adhesion fragments 0.0086
Further Details:      
 
Weak hits

Sequence:  gi|427730416|ref|YP_007076653.1|
Domain Number - Region: 5762-5913,5960-5984
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.00017
Family Tricorn protease N-terminal domain 0.033
Further Details:      
 
Domain Number - Region: 6010-6060
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000255
Family Type I dockerin domain 0.0077
Further Details:      
 
Domain Number - Region: 5065-5154
Classification Level Classification E-value
Superfamily Cadherin-like 0.0022
Family Dystroglycan, N-terminal domain 0.069
Further Details:      
 
Domain Number - Region: 7344-7386
Classification Level Classification E-value
Superfamily PKD domain 0.0068
Family PKD domain 0.013
Further Details:      
 
Domain Number - Region: 7502-7576
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.0138
Family Glyoxalase I (lactoylglutathione lyase) 0.077
Further Details:      
 
Domain Number - Region: 10666-10690,10722-10748
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.053
Family Type I dockerin domain 0.0077
Further Details:      
 
Domain Number - Region: 8179-8339
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.0562
Family Tricorn protease N-terminal domain 0.04
Further Details:      
 
Domain Number - Region: 10138-10225
Classification Level Classification E-value
Superfamily Cadherin-like 0.0628
Family Cadherin 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427730416|ref|YP_007076653.1|
Sequence length 10755
Comment RHS repeat-associated core domain-containing protein [Nostoc sp. PCC 7524]
Sequence
MFTENSSPIPNIPDLQKNSPFDLPNENLGITTLVVNGATDYPMPTLAQLNSNYEVSTLSI
DDIDESALTTKSLTGDSTRPLVGASALVGTIFWTGGGEENNSWFNVNNWNLGRLPGQGDI
VVIDDNDPNKDIIVKFDSAVNTTVGAIVSQEILEITGGTLSISNEASLNQLWLRGGTLTG
SGNIDTNVFEWRAGTLSGSANTTMSVGTLNISNTNPSANFSKTLSGRQLTNTDTATWQGG
NVTTSNGAKWINQGQLYIETNDSFSGTLDNQGSLIKRNSTGTNNFFGSLSSSGIVSIDSG
GLYLLGNGTFDNTVVIQEGSSLRLGNEGVDIYNFATSATLEGGGTLTMSAGTLNLQGNYQ
LSNSPIFDGGTTNFNATITQPFAVMNINGGEVNFNTPQDTIVITNLNQAGGTLKGQDNFQ
VGTYNWRAGTLSGSANTTMSVGTLNISNTNPNANFSKTLSGRQLTNTDTATWQGGNVTTS
NGAKWINQGQLYIETNDSFSGTLDNQGSLIKRNSTGTNNFFGSLSSSGIVSIDSGGLYLL
GNGTFDNTVVIKEGSSLQLGNEGIDIYNFATSATLEGGGTLTMSAGTLNLQGNGAIAFLT
LSNGTLYVNGVLTATNTFEWSGGTLSGNGVTNIAPQGTLNLISGGRTLGAGHTLNNWGTV
NWRVGGISAGQGSVINNQGNFNIFNTNGSGMVNGILTNTGIVTKSLDRNTLDNSTPFQRV
TFNNSGTANVSSGNLTFTEARVVNTGTLPASGITYVNNTTQVTNPSLPDLYIIAEGINAP
SQVDPGSTITVNWRVGNRGNAATANQPWSSGVYFSTDNQLDITDIFLGRSLETTILSNGS
IAENLTSAKFVFPRVAAGTGYLLFVADDRYKQFESDETNNVVVKEIQVTNTPVPAVAPDL
VVTDVSVDNSQLIGNPASVQVTWKVKNQGTATATSWRSRIILSQNETIGDSDDLLLGSEF
TNTGSLIPNSVFDSFQRTETVTLPTNLRGSYYIAVTTGLTSGVEISRLQHSNLLAYFPFE
GNAVDVSGSGNNGIVTGAALSNQGYSGQAYSFNGSGLNPQVIRVNLDVNPSHYPLMSWGA
WVKPSTQGQMAIISHDNGGFDRSLVIDNRNTNSTTTNTFRWSTFSGSGTLLNTTNVANAP
EIPIDTENWTFIAATYNQTTGLVSLYVNDQVLTETGIFNEGLNYLHIGSNPTFGGYFQGL
IDNVFIYNTVLSKEDLDAIRLRGVPLGNLGLTGTYNNTSRPLGIQVSLPANGSPNLSLDS
TQIAENSAVGAVVGRFTITDPDVTDTHTLAIVNQDADRPFAIQRNLQTGQYELVVARANV
LNYEAKTSYNISVRVTDSGGLSVEVPFTITVQDVNERPTNITLNPISVPENSAPEILVGR
LTTTDPDVGDSHSYTLLSGNEWFTLVNGNEIRVAQGAVLDFESQTSYVINVRSTDAGGLS
VDSNLTINLTNENEAPSNITLSANNIRENSPNGTIIGTFSTTDQDRGSSFTYELLNNAGG
RFALNSNRLVVADSTLLDYEATSNPQFTIQVKVTDNGGLTFVKDFIINLLNAPDVDLQVD
FNPALTLPTSAFLGQTLNVSWIVTNNSNETTSNVAWSDRLYLSQDKTISNDDIQINLPAV
KVPLAGGESYTRTIPLPLTNAQLIAGKYYIIIQTDVGNTEGETNETNNQIVSDEITLNPA
PTPDLTVVEIEPTFPTDLTQKDQFFLTWRVADLTGNGISNQTWVDKVYLSKDGNLIEIGS
FSRNQASLGTISRQITIPENLADGEYELLVVTDADNTVIESNENNNRLLVSGRKIIISHA
DLVVSDVEISTEIAVEPTDNTGRSSFVTIPNQVPVKVSWKVTNSVAGIGSSNTWVDQIIA
ISRTGIERVIGEYTHTGFLSEGESYTRDVTVNLPIGFFSERYDLYVQTDATNQVAETTTG
ENNNRGKAEQYLDVATSRYADLVITDANANLVIPDTSSPGGNFLNVSWTVKNEGIGPTNT
NTWTDIVQLARNSDGTGIISTRTFQNFGVLDVKNTYNRSVQLPVPNGYAGPVYVVVTAGN
PYEFIYTNNNRRIISSVIQIPGDRNPPNLQVTEITAPQTVQAGATIDVTWKVENKGRTAT
GTWVDRIALVPQNQPNAAPIVLGSFIYNNSLDENGSYTRTERLRVPEFIGTTGLQGLYQI
QVITNANALLNPNSTNLIYEGNITDNTTVDTDAIQINFPFYPNLTVSQVEPIGELKAGGV
FSVKYTVTNEGVVATKTPRWRDNVYLSYGRNSQGVFTKDIFLGAIDNASALAASESYTRE
ITNLRIPDNYSGPGYIVVEADGGNVVQEYPQEDDNLGGSQLFNIQELAPADLLVSDVVVE
QIEVDEGTSFTVRYKVTNVGSERTISSTGGWIDTFWLAKTRQRPSPIAQGADGFFPLQDI
LLSTQRNRNITLNPGQSEYFRETITLPQRVTGQWYVTPWIDAFDAVREVTSAIYNNPDDP
NQLDSNNYKASPNRLVIKPKIAADLAVSNVTAVLTSAPVTVPGGDRTLKVDWTVTNLGAE
SAANWQDFVYLVTDTGDRVGLARINSRQQLGAADTTGSSPVYQSYNNSAEFQLPTSAKAV
QVIVTADPWFGTSEVWEGGGTSEIDNNSANTTVEIDPLPADLRVNSVTVTVADTQRPFHS
GEGVNVKWTVQNYNNPIWTGTQSWTDEVYLWQGNPDDFEPHKGTLLSRFTIRREEVANNQ
YTQTQRVTLPRGIYGDYYIYVITNAYGGSNPTVNQRTYRDRAFENSLTNNRKRSDSFPVI
YREPDLQFTQLRIANQVFDVNNLPSTNTPLANLPQLNSGKPVSLGWTVKNSDTNGEGRDT
REGIWTERVYLSEDTTLDSRDQMIAFYNRKGALLKESSYSATINDFRLPDGISGKYHLIF
FTDANLFGQLPPLEPGLRNLGDSVPEFKYEGNNIKVVPVNITLTPPPDLEVTNITIADLP
TDKNINIGQTINFNYTVTNTGVGEVPPNQRRWRDLVYLSADRYLDLNSDRYLTSVDVGLN
QPLVGNPNNYTNTVTFKLPTDLTGPYYIIVLADGDRSSPAGAVYEADDNNNSLASTVFNI
TVPPPADLQVTNVTVAPGGKVGGEIAVEWTVQNFGNLAKGRWRDALYLSADGILDINDRL
LGTFDQPSIINGSLENNATYTNRQNVTLPGVLPGQYRIIVRTDIFNEIYEDIKDNNNVTA
STDAFNVSADTLQLGVTSQATLTPKRVDQQIVTQERLYRVDVGFGQTLKVNLTSDRPNIF
NELYIRYNDLPNGQNVDASYESQQPGNQSLVIANTQAGSYYILVRGLYNQETELSLLAEL
LPFSITNVATDRGGDTRYVTTHIYGAQFSPNAIVKLVRPGFGEYAPVSFKYVDGTHLIAT
FDFRNAPLGLYDVKVINPDGRQAIAPYRYLIEPATPLDADIGMGGPRILSFLPPGNVGRY
QVALRNLANFDAPYAFFQFGLPQLGGGLLGTPKVSFSSNLGGQPNNLTNINWTSLDSSVN
TNGTILAPGYLIDWEAKGSQGFNFTAHIFKGIEEILARNPRALDGVLSDPNVDLSFKFHI
LAAITPMTPQEFKDAQRRDANKLRLAILQDPNAPSGLILLAADENGWSDLYLKALGQAGI
LRQEDTPPNIDTEPYVVSAMAVLASGIPLNEQGVPYVTNANIVEFFTQIRKWYGHQADLL
GREEPPAPSEYDLGLSSPTRFEAFNVYVPHRTRLDLPGFVETTRVDFSNFFRGTASTAGE
ISSIIGPFGAGSEQFLPLGKPLPYVIGFQNPADSSNRPGEIIIRSILDNNLDARTFRLGD
IQIGGLPIPVPDNVTNYQTNIDLSQSQGYILQVSAGVSVVNNETIASWVFRAIDPATGLL
IPVGDIGLLLPNNENGAGEGFVSYTILPKTPATDQTQPISISAQARVTFNTLPPDDTATL
THTLDVRSPETQYQVIDLQPNAASRTYQVSWSATDETEGSGVQSYNIYVAEKGSSNYTIW
LRQTTETSGVFQGEAGKEYNFLVLATDRAGNQEAPPAGVRLPDTGDTTNLGSLPDVSTTP
IDLGTLPPRNPNAIPANELFKQIQTTPSANSSTRPSEFDRVLSPFQAESFATGIPQSHGN
IGPMAIAIRNDGFVIASGGVNRNQLFLLSPAGGQVGTPLITLPHPIFDLAFDKNRQFLWA
TTGGGPLLKLNANTGELIESYAYSTGITQALAIHPTTGEIYVSSGDGIKVFNPNSKTFSH
YSDLRVGNLAFGPDDKLWGAVWPQRGEIVNFTEIRDITGRLVRTTPQLMARFNDAVDSIA
FGQLNTELAGLLFISTNNGDLEVIDLDSMRTLTLAEGGSRGDIIRTTKDGQILLSQSAQI
DILSPIRQPRVAATNPPDDARVTLPNSTLTVTFDQAMFVGAATDSASVLNPNNYQLTWLN
SENVIQGNIQPTSVSYNATTRTAQLVFDNLIPSQYQLRVNGSVRSQRNQPIGEDYVTDFT
AISDFLANVDLQFINTRSDRNQETASWDVTVKNKGSYDLVVPLALLLDPAQSFTGVIPGQ
RTDLGYLLDLSASLPTNGILRAGATTTAQVITVNNPDQLRIAFAAGIYTLPGDNQAPVIN
SQPITTALVGQQYQYQVQATDPDGTIAGYLLTQAPANMAVSSQGLITWQPPTGTASNTRV
TLRVYDTRGGYATQSFNLQVQGANRSPILSPLPTQINGQEGQLIELPIGASDPDNDRLLF
WINNLPPGAVFDPETRLFTWTPDATAAGTYENVQFVVSDGKQQVSQSVTFAIAPTNQAPT
LINPGNAYGGQSQRSIRQGETFILRLAATDPDGQTLTYFSNNLPAGATINPVTGVFEWTP
GYNQTGIFRIPFSVSDGQLTTTQTVNIEIIDVNAAPVFDTIGRLQVQEGQQLRFRVFALD
PDNPGYIPQERRDDGTLTPLEGTEATIEYEAVNLPTGADFDEDTGIFTWTPSFNASTQTY
SVKFIAKEIGNGLTSEMIVPITVLNTNRRPVVTLKTADGQPVNINQPIALTRNQSRTLVF
EATDADGDTLALTARDSRGRVFPGFANFIDLGIVDGKRRGELILNPNFSDRPEDYLFTLS
AAEVNNGLNNLTEAVNFTVSLLPYMSPIGAKAVKVGSNLSFEIPVIAPTNISLDYTWELS
SPLPPGASFTTSADKQTGLFNWTPNTAGSTAITLTLKHPNGQVLDTQTFTINARTADNLA
PSFSPINLTATEGQPLDVFLGELLSNPDGDALTYTISNLPAGAILNPFTGRLQWTPSFAS
TREVPLQLTITDGSNTFTGALKITVADVNQQPILLPLPPQQIREGAPLQFTLVGADGDND
PLNYTVVSQLPTGAVFDATTRQFRWTPGFGQAGKYTLTFAVIDSQQARGTVDVEINVENV
NRPPSFKDLFNRTAVVGKTLEFTLEGEDPDSGTTLTYQAERLPQGAIFNSTSRKFTWQPT
PGQLGDYTVVFNVSDGETTTTQTILIRSLPTSTDLPVQVVVTPGFPAVPKQQVLIQASVD
SLAGVAREDLVIKVNGNPINSQALGRAVYVPDAPGTYTIEITATDRDGLTGKATAILKVR
DNNDTTAPVVALDPELAGLKIISTKEIRGAIADTNLDTWQVELAPYNSNNFVTLATDDEQ
RQNTTLATINPETLANGFYRLRLTAADIGGRTSQQEVIIEVNSANKLQSPITSTDLAQIS
LGGVNVNLVRVYDALNVDKFGSFGYGWSLSNIDTNLQVNLPVTNREEFGNYNPFKLGTRL
YLNLPNGTRGGFTFRPQAQDIAGVKYYKPVWVADNGVNYTLASTDTLLIRASDRFYEINS
GQPYNPANPALRGTAYTLTAANGTIYKLDGRGRITEQITDGKRLFFSDSGIISSTGETVR
FVRDAAGRIAKITDPNGREVIYQYDNNGALVNVRQLYAGTSSRYGYSLTRPHELIAIAEP
NSPTDLGTAYRFNNAPAKVGEITTAGEVDQFTFTIRNSELRSTESGLVLVGIEITATSGN
LKLAAPTINGLTPLSTPRIFADGKRVYALYAIDREALYAINIQGADNTTGAYSLKLFIAG
DVTGSNNSLDETVDGRDYQALLNALGTTNNDIRNNLRYDLDASGEVDAADLEILGRNFGF
VANTPPRIVADLPEILTHTNLEVTVPLSNLVTDAEGDPIYFRTDAFSRGTIRLSPDGKSI
IFTPEKDFSSATGASFSFIADEGFNDSASGVIAVNVSNEPLQRIRFGQRQIQLEPNNSQR
LQFFGDFADQQNVALPFSYLNLNVENSVIATLNEGIITTLSQGVTTIQASKNGISAITNL
VSGFPRTRNQQLLLVQGIDPLPDSVLLSGIGATQQLKVLFGETDLTTATQGTRYFSSNPN
VIQVEENGQIIAKGLGSAEVTIISGAAEAVIPVRVEAPQGSTSPIGSQGGILTDNSGVTL
AIPINALAATTNIAITPLTLNQFNLPLVEPFSYVDSFRLNLGNQIFRQAAQLKVAVPQTI
PVNSELFIYQAGTSPDANGTLVPTWFLVDTAIVGADGFAQTGTNPFSTGIYESGDYLIAY
APPNTIGKVRGRIAFANPFAITTQEFQIGAEVSLGDDTPQTIQTFATFSKLATDVEVEPT
PDEKKLYFKLRFAQFTVGFLRGEYFELPLPQNIRRIELTEVPLEGLPRVTSTEVQIQPNA
VNTFATSFNNIVLGPDHPSAAPQIDEISVEIAEVNGVTRSVVKLVGERFRYQNIIGDVIF
TEKHTGTQVIQTGNEVQFSVEGDKEVLRAIIPQKLAVGNSTIQVKRTQPSLREGLPPIAP
PALSPTVEIAARPSYIFGALVSVDQQVVAINQTTRQQVARIPISVTNSTFVVAKDTIVTP
DGTRVYVPFYDPAGFSSGVAVIDAIALQQIDVDPSTAAIDVISLGTTNRPNRIAVDPQGR
FAFVSDEEAGTIYQIDIDPNDTQPYSAKYNSVLANIGDIFTTAPVGLRGLAVNKAGDRLF
VAAPGRTAFGNTRTQPNNIDYIHVFNINPNDRDNYRQLIGSILAAPPGVAGTEVMEIQAT
HDPNIITFTNRRLDDYGVGILKNVNGNVSDINVSHIPFNLLPPKQYPDLAPLFSPPGENL
LFDSFDVNSAQAIAILPANTLKFTDADPNHPTFAFVSAFNLFAPDSPSRNPDHPRRRLGV
PGGSNIAIISNPFGNPGEGPTQVVAATRPIPLGFMDNLVLSEDGQFLFAAYGGVNSVFVY
NVKEIITDIGLHERLYFEGKVDPRLNLIRLPINNQTTTVNNGEIIVLEQPNYTIDINADY
RLDIPFRPPNRPNDPLVFRNFASAFSPIGTGNVRGLSTQSEPVVPLELQLYSIRNPLPPQ
LPTPLPTPTPGTPIAGDSTRRIHLYTRIDPVNRQVAIGEGYFTFAVNKKARVSLRIQGAV
AQGLQLIDPVTRNTTTINSLDNVEFGPGVHYLLIQPIGQFGTPGEYNFVLTATDEDGNTV
TTTGVIDHEVEINNSFPIGQTVVKGVNLWSGHLTTTSQDVVIPGRGLSLDFSRTYSSAGD
SSRGPLGAGWTHNYNVRLIGDKFGNLTVVGGDGSGNTFAINSGHFDPVRARLLGLPEGAR
FFDPQPGYHSLLVQPDPTVNVFDFYTKSHIRYRFEQNDIQPFLSGLNFNLKFIEDPNGNR
IELYYDRTDHNWNSLPDTLKYKIDSDYNTLDVIRDSSGRALILKYDTIFFDQRITSVTGY
NPDPNNIDLYDLYIDYDYDNFGNLTKVERVGTLPSETRIEKYKYTPGDARTGHNLIAYTD
PNGNTVEYSYYETGDSLSFGDIDSAFSIRPYEFVKEVREPSTNDHSSPIIKFTYDLLGNK
RTVTDPRLNVAPTVYTLNSYGAAVKIEEPLGKVTLREWATPDNPQDPTIVPGTRFRPGVD
VVLVSETDALGRKISYRYDAQGNVIEEKIDFSAMAGYTPVLNKQGQPVDHIITRYTYDPI
FNKMTSKTDAEENTTIFVIDSPAFALPDGVELPTSVPLPTGRTGNLLAVVDAEGNFVQYQ
YAERGRVYNGVYGAGDLISVTDPRGRVTKYLRYDQYGNPIVIEDAQGNQVTRVFDDRSRL
KSITDTSGRKVEYDYDSLDRQIEKRQIDTLYGLTSQIEQYEYLPQGQLRQVIDGLGQVTE
YAYDALNRRIRQTELDILQADGSKQNLTIEYRYDAVGNMVLQTDPRGVVRQYTYDALNRL
QNIRILGRPSGTGVGINSVIASYGYDLLNNRLFEVNLNGDRTDFRYDRLYRVVTTELPFT
DNQFGTGKATVDIQYDRVGNILRQTDANGNATTFTYDQIYRLLSTTDADNNSIEYRYDAN
SNIVQTIRKSNDVVTHIVTIDDGKTIADGLNRPTTVQELVYLGDPSNPNTPTVTYTTSYL
YDDKNNRLVVTNPRGFKTEILNDGLNRLYRQVLDFGGLNLITEYTYDANGNVVTIKDPQG
YDEQGNNTARDVDVTYTYDGLNRRIQAAYLLGLTETFVYDQNNNLIKYVDQRGITFTSEY
DNLNRVLQQNVRETISNGGEWLALAKYEYNDPQNKVVEIDANGNRTEKFFDALGRPSKLV
DPLGFTVTYAYDGMNLRRQTDKKGHVTEYFYDAINRPTRIDEYDNQGVFQTRVTTVYEDE
KNRILNIDRRGITTINQNDSRGRLVELSRQHPDLLDRYNTNTVVLATHAYDGNNNKVRSI
DAQGNITTYEYDGADRMTRMTEGFNSPVAAVTTYTYDRVNNLLTVKDAREHGGSFDVQYT
YDSRYRRIRQTNAEGETTTYTFDGNDNVRSITEPLGQDYTTFYRYDELNTLLSVDEQRGG
IGGITYYFYDGNRNKIAQQDANGNLVTYKYDALNRLTDFYQHYVPGTIDTNTVRGNNPRG
TNFNPGGNQATALHWQYGYDPNNNQVLTIDANSQRVESIYDYRDRLRSVIYSNHLNPNLD
YQMQSLTYEYDANNNPITKTEVKRVGGTNITETYNYVYDKLDRLQSSTNYDNKTIQYQYD
KQGNRTQIIDPDGIITRYNYDQRNRLIAAITEDGTTVYQYHPDSLLKAIIYPNGAIADYS
FANAYDKADRLTRFVNHTGTVGNVSGILSQYEYTYDDNSNRIRQVETQRDINAGQSEVTT
YTYDRLNRLVEVTYGSKSKVGYTYAKNGSRLTETTQDLATNATVTQTYTYDRINRLRSIT
NSTNAAQSVAFDYDDNGNRISKTVGTVATTFDSNGNPITVILNPSSSLTYEYGIRDELLR
TPNLNGGFVTFDYNSDRLRVKKKTATGETRYLYDQNATLVEYDSNRNTTVKYNYGYALLS
LTDVTVPGSTNASDRQSQFYHYDGLGSTANLTNESGNLQISYQYDAWGNIRTQVGQSVNR
KQYTGHYFDSETDLHYFGARYYDADTGLFISQDPYLGDINTPPSLHRYLYAYANPLRYVD
LTGYSSVEANTKPWFMQDFNTESNPGRRLLYDHWREQQKLDYQRKIDEYNHRELVATWQE
QQREKEKREGTVGEQLISVLDGWSNSVALSGNAGTLEAFGAFAVDIATGPARIALWLFGD
VGKGTGTLWGKLDTPAGEAATFWDYLGAALDVVDIATTIIGAPKLATAIAKKVAPITRTA
TQAVSQVAEQIGRKTTTVGEKIAASQIFEGVESRTVLKVTDKPNLPNQSRISTPINQTSS
PTTLANIPEPLDPSLVRLIETQSNLQNMKVDRVAEFLTAPRQFRHRLTSDMPMASYARIE
KEGMRLSTGAKAHYGEGVYAWEAGQPGVGGQYIDFEALPGTAVERLQFPDGRFWYRLVPE
SGNNLPIRIVGSNLSPEEIAMGRRMIADQKGSVLGVEASILNLDSSTLIAAIDTWTKIID
FISPLQLTVKVQELPENSIGQAEIKQVNQLRWVTSGTILLDNDAAGVGWFVDTKPYAGVE
FSRQLGSNVTQALAGSAAYGKYDLYTVLLHELGHIFGFDANNNRFQQFLTTENGSPVFTT
ADGTKVTLSADGNHISDTAHPEQLMNAYLAPGVRRLPGELDIKVIQSVRGSQPVANVLPT
VTNLTQLPVTSVSESPIPVEQQLDLPQVVAVNTQTTTTANSAIANTIINGDFAIANGNGF
GWTTQGAASVVNGQGVLEESAFQQSRFAQTFTIPQGSQTLQFQLLNVNLEQTANNPADAF
EVALLNPTSKTALIKLNDLSNTDALLNIQPFGQNQGKIYYNANFVQISGVGASGSVISLN
TPLTVNINLSSFAVNGSTPATLYFDLLGFGDRDAKVTIDNVAFITGGNLPPVAVNDQVTT
NEDSAVTIPVLANDSDSDGTLDTTTIAIVDDAQNGIIQVNPDGTITYTPNADFNGSDSFT
YTVTDNAGAISNPATVTVTVNPVNDAPVASNDTIAVNQGTSINIPVLDNDSDSDGSLDMG
SVAIASQPSNGTVIVNDDGTVTYTPNTGFAGDDSFTYTVKDNQGAISNFATVSITVNPSN
NIAPVASNDSIAVNQGTSINIPVLDNDTDSDGTLDSSSVAIASSPSNGTVIVNDDGTVTY
TPNTGFAGDDSFTYTVKDNQGAISNVATVSIEVNNLSPVITEITGDTNLNEGDTGIFSVI
ATDPGNDTLTYRWSFGDNNQTVTGQTVQHTFADNGEYIVTLTVTDAYGATTTQTFTVTVA
NIAPIVNAGADQTVTQGSLVSFAGQFTDPGILDTHTIEWDFGDGNTATGTLNPSHRYERD
GSYTVTLTVTDKDGGRTQDTLQVIVNTQLPKLTVDDVTVNTDEQNNTFALFTVRLSAPSN
QPVSFNFNTSDGTAKAGVDYTASTGNLTFAAGETIQTIKVMLNQPKAGDINRDGKIDQAD
MNLLLAARNQPATAPQPTNKDFSLNIGNVTGAILDDSLGVATLFGTQTDARDLDGDGMIT
VLDARKLALIIRSQG
Download sequence
Identical sequences K9QV67
gi|427730416|ref|YP_007076653.1| WP_015139489.1.5551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]