SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427730715|ref|YP_007076952.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427730715|ref|YP_007076952.1|
Domain Number 1 Region: 33-327
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 3.92e-63
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427730715|ref|YP_007076952.1|
Sequence length 340
Comment putative photosystem II stability/assembly factor-like protein [Nostoc sp. PCC 7524]
Sequence
MVILKSWQKIFALLLVVFMCIGCSKVPSTSYNPWAVISLPTEANLLDIAFTNDPQHGFLV
GSNATLLESHDGGDTWQPLTLALEDDRYRFDSVSFAGKEGWIVGEPSLLLHTTDEGRSWS
RIPLSEKLPGNPISIHALAENQAEMATDVGAIYTTTDGGKNWKAQVEAAVGVVRNLKRSA
DGKYVAVSAKGSFYSTWEPGQNAWVPHNRNSSRRLENMGFSQDGQLWLLARGGQVQFSDP
AKPDEWQEAQTPELSTSWGLLDLAYRTPQEIWVGGGSGNLLLSTDGGKTWEKDRDVEAVA
ANFYKIVFLQPDQGFIIGDRGVLLKYQPDGAKTDKTEASA
Download sequence
Identical sequences K9QUS4
WP_015139783.1.5551 gi|427730715|ref|YP_007076952.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]