SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427731501|ref|YP_007077738.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427731501|ref|YP_007077738.1|
Domain Number 1 Region: 131-205,238-434
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.000000000128
Family DPP6 N-terminal domain-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427731501|ref|YP_007077738.1|
Sequence length 496
Comment hypothetical protein Nos7524_4382 [Nostoc sp. PCC 7524]
Sequence
MTTKAFLQPLDRVAIAFMLLLSIMIGFLILQGDVVAARVRDFSWQNQQIGAEDISFTFTF
SRPMDAKSVEDNLKIEPPLAGKFSWVGRRMVYTLLTPAPYGANYTVQLQDAKDKFSQKEG
SNRVIEPFIGQFRTRDRVLLYIGAEQQDKGRLVLYNLTKEQKTLLTPKDLVVMDFKPFPN
GEKILFSARASNNQDLLSAQLYTVTTGIAAKIDTPTAAAGKVDLVLDNKDYQNLKFDLSP
DGQTIVVQRGNRNNPSDFGLWFMPASNQPGERPKPQRVQSQPGGDFLITPDSKAVAVAQG
QGAAILPLQQDASKPLDFLPQFGLVQAFSKDGSQAAMVKFNTDFTRDLFLVTNQGTQKPL
LKTTGSILNCQFDPATPTLYCLLTQLVSQTEYIEQPYLVAIDLKTQQQKPLLVLPVEQRN
VQMSLAPDGLALLFDQVVPQANPTAPSANNLKTDDGEAIATSSLWLMPLLPISDSAISTI
KPEKLPLVGFHPRWLP
Download sequence
Identical sequences K9QYA8
WP_015140551.1.5551 gi|427731501|ref|YP_007077738.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]