SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427731729|ref|YP_007077966.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427731729|ref|YP_007077966.1|
Domain Number 1 Region: 62-163
Classification Level Classification E-value
Superfamily beta-Roll 0.000000000000406
Family Serralysin-like metalloprotease, C-terminal domain 0.00097
Further Details:      
 
Domain Number 2 Region: 698-789
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000903
Family Cadherin 0.023
Further Details:      
 
Domain Number 3 Region: 5202-5289
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000107
Family Cadherin 0.029
Further Details:      
 
Domain Number 4 Region: 1085-1174
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000353
Family Cadherin 0.034
Further Details:      
 
Domain Number 5 Region: 4836-4920
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000785
Family Cadherin 0.027
Further Details:      
 
Domain Number 6 Region: 1451-1537
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000236
Family Cadherin 0.022
Further Details:      
 
Domain Number 7 Region: 4925-5015
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000659
Family Cadherin 0.046
Further Details:      
 
Domain Number 8 Region: 5017-5104
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000691
Family Cadherin 0.021
Further Details:      
 
Domain Number 9 Region: 993-1079
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000107
Family Cadherin 0.0061
Further Details:      
 
Domain Number 10 Region: 607-693
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000286
Family Cadherin 0.021
Further Details:      
 
Domain Number 11 Region: 791-874
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000628
Family Cadherin 0.024
Further Details:      
 
Domain Number 12 Region: 883-981
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000877
Family Cadherin 0.0071
Further Details:      
 
Domain Number 13 Region: 507-593
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000995
Family Cadherin 0.021
Further Details:      
 
Domain Number 14 Region: 4521-4592
Classification Level Classification E-value
Superfamily Hypothetical protein PA1324 0.0000000288
Family Hypothetical protein PA1324 0.017
Further Details:      
 
Domain Number 15 Region: 407-493
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000458
Family Cadherin 0.034
Further Details:      
 
Domain Number 16 Region: 4315-4504
Classification Level Classification E-value
Superfamily vWA-like 0.000000161
Family Ku80 subunit N-terminal domain 0.069
Further Details:      
 
Domain Number 17 Region: 5110-5195
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000414
Family Cadherin 0.014
Further Details:      
 
Domain Number 18 Region: 4739-4830
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000115
Family Cadherin 0.025
Further Details:      
 
Domain Number 19 Region: 4195-4284
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000447
Family Cadherin 0.035
Further Details:      
 
Weak hits

Sequence:  gi|427731729|ref|YP_007077966.1|
Domain Number - Region: 4621-4678,4705-4733
Classification Level Classification E-value
Superfamily Cadherin-like 0.000549
Family Cadherin 0.042
Further Details:      
 
Domain Number - Region: 1543-1601
Classification Level Classification E-value
Superfamily Cadherin-like 0.000895
Family Cadherin 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427731729|ref|YP_007077966.1|
Sequence length 6955
Comment RHS repeat-associated core domain-containing protein [Nostoc sp. PCC 7524]
Sequence
MYTEINVFDLEPSPVLAPSPLASPEQLGRLDGMEKLDIPVITPDFSIAINSQTVLVEPSV
NEIIGTGGRDVLTGTALSDRIIGGFGADIITGGSSADIFVYQSIRDAGDIIKDLELRQDV
IDLSVVLTSVGYQGFNPIADGYIQFGTYTGGTVILLDSDGKGSLAARPYIYVENVTPNDL
SSYPNHFIPNPGEPPQIEASLVNDTGVSSSDRLTFDPTISGKVSVTSNLVSLKAGLNNQL
VTVDIFDTLNSDGGFNLTSARLAQINGGVLNDGAYTLKLQATDNKGNISSVYSFDFVLDT
TAPILDLQLDPNFDSAPVGDLQTTFEKVNLLGTTEANLTVSLQPTGVSSTTNDLGEFTFA
NISLSQGSNLFTVVATDLAGNRGEFSQTFQRLTPQVNAAPTNLNLTPASSAENVPDNSII
GTFTTTDPDAGDTHTYSLVTGEGDTDNTAFTIVDNELRIKQSPDFEAKSVYSIRVKTTDA
GGLGYEQIFSISITNVNEVPTALNISRGAIAENTPANSIIGTFSSTDPDVGDIHTYTLVT
GEGDTDNTAFTIVDNELRINESPDFETKSVYSIRVKTTDAGGLGYEQIFSISITNVNEAP
TALNISRGAIAENIPANSIIGTFSTTDPDVGDTHTYSLVSGEGDTDNTAFTIVDNELRIK
QSPDFEAKSVYSIRVRTTDAGGLGYEQIFSISITNVNEAPVIEAIATQNINEQTLFTLTV
KASDPESDTLIYTLDASAPPGVSLDSTTGVLTWTPLETQGPGSYPITIRVTDGQLTTFQS
FTVNVAEVNTAPILTPIGNKNITLGETLSFKVTAVDSDSPVNNLSFSIDDGAPQDVQIDP
VQGTFSWTPTTAGLYPITIRVKDDGSPILEDFEIIQVAVIASNLPPTDITLAPATISENV
PLNTVVGVLSTVDPNGDTNFIYALVSGDGDSDNNQFVIDGSQVKLKFSPDFEAKSTYTIR
VRSTDSTGLSLEKALTIKIADVNESPTNIILSNATIAENSPTNTFIGSFTSLDPDLGDSF
TYNLVNDAGGRFAIAPGTNQLVVADSSLLDFEQGNTHTIRVKTTDIGGLSFEKDLTISIT
NVNEAPFFTSTPVKDAEINSPYQYLITTGDPESDRLTVSATNLPSWLSFVDHQDGTAVLS
GNPQFGNLGIYTIPLTVTDTGGLTATQTWEISVGATLREGTNFSPELTTNLLIPNQPQIL
SFQVEPNFDLSDRNSIKDAFEVALVDSQGNSLVHSFTAGRDSFFNITEGLAVVTGAGTNY
NPATQTVTVNLTGIAANTNARLIFRLVNNDSDTTSSVGIKEINLSDAPLETQPPLSSAIA
TLGLNSNSTPLNFTNVADVTPSLQLQYQRTSFNEDTQLLYTDVVVKNIGSYGINTPLIAV
VKNISDPSVQLRNIDGYTPEGLPYYNFSQLVPDGKLNPEQVSSDRSFVFYNPLQVQFTYD
IRVYSVLNQNPVIQTQPALEIIGGQSYQYDVNATDPDQDPLTYQLLIAPQGLEINPTTGL
LQWNTNINNIGNHHISIQVSDGRGGITQQTYTLAVIEQPPNRPPIFISTPVVDAAINQPY
KYDADAVDPDQDPLTYSLVLGPDGMKVNPTTGLVEWTPPSVLTLGDTVIGRISIPGEVDE
FTVSGVAGQRIYIDTLQYSGDYWRWQFKVYSPSGLLINDSRLDDNKLLNLPENGNYRIVL
RTDGDLVGTYGFRVIDQNLVPIVPLDTFIQNKLSPGSQDHLYRFTGSQRQKLFFDQLSNN
GNLDWVIYNASNQVITSNNFNDIEIDLPVAGEYTLAVRGREAFTSSVDYAFSIITPEIVN
TPLSFGSVITGAIAEKGEQDTYTFSGEIGQRLYFDVLNRGGVYTTIANLYSPSGRNLLSR
WLYEQDPDPITFTEAGTYRLVIDGNGESTDHYSFSLLDVGQASAIALDTDISGQLDPGQE
THFYKFNGTAGQRLYFDALTNLPSTSWLLYNLSNQALVNQGFSDYEYTLSQTDTYLLAIR
GNSNTVVDYQFRIITPEFITASLTIGNTVSSNISEKGEQDTYTFSGEIGQRLYFDILNRG
GYYSTIANLYSPSGRNLLSRWLYEQDPDPITFTEAGTYRLVIDGNGESTDHYSFSLLDVG
QASAIALDTDISGQLDPGQETHFYKFNGTAGQRLYFDALTNLPSTSWLLYNLSNQALVNQ
GFSDYEYTLSQTDTYLLAIRGNSNTIVDYQFRIITPEFITASLTIGHTVSSHISEKGEQD
TYTFSGEIGQRLYFDVLNRGGVYTTIANLYSPSGRNLLSRWLYEQDPDPITFTEAGTYRL
VIDGNGESTDHYSFSLLDVGQASAIALDTDISGQLDPGQETHFYKFNGTAGQRLYFDALT
NLPSTSWLLYNLSNQALVNQGFSDYEYTLSQTDTYLLAIRGNGNTSVDYQFRIITPELTT
ATMTIGNTVSGSISEKGEQDTYTFTGTAGQQLFYDALGGDYLRLRFYDPTGREIFNRDSR
SDIGPDVGLVLAMNGVYKVVVDGEGEGVGNYNFRFLDKATASLVPLDTDITGTFDNNGIG
STLYRFQVTGDSKRLLIDGQTGVSPNAWILYSHAGQFLTNNSINRDSEVVVSPGEFLLVM
QGNGASDRNYQVQIKTLQTITATPFNDETLTLGSTVTGTITQTGGQKGYRFTGTAGQQLF
YDALGGDYLITRFYDPTGREIYSADSRSDRGSNGGLTLTMNGNYRVVIGGTGTGNYSFRL
LDKATAPVVNLDTDITGTLDNIIGSTVYRFNITGGSKYLYIDAQTGTYYNNWIIYAPNGQ
HITSAYIFEDREFSAGEGEYLLVMQGNGASDTNYKLRIITPELITSAITLGNTVSGSISE
KGEQDTYTFTGTAGQQLFYDALGGDYFRVRFYDPTGREIYNADSRSDRGTDGGLVLSMNG
TYRVVIDGDPNYGNGEATGNYSFCFLDKATAPVVNLDTDIIGTLDNIVGTTAYRFNITGG
SKYLYLDAQTGTYYNNWIIYAPNGQHITSAYIFEDREFSAGEGEYLLVMQGNGASDTNYK
LRIITPELITSAITLGNTVSGSISEKGEQDTYTFTGTAGQQLFYDALGGDYFRLRFYDPT
GREIYNADSRSDRGTNDRLVLSMNGTYRVVIDGDPNYGNGEATGNYSFRFLDKATAPVVK
LDTDIIGTLDNIVGTTAYRFNITGGSKYLYIDGQAGTYNNQWIIYAPNGQHITSAYILED
REFWAGEGEYLLVMQGNGASDTNYKLRIITPELITSAITLGNTVSGSISEKGEQDTYTFT
GTAGQQLFYDALGGDYFRLRFYDPAGREIYNADSRFDRGTDGGLVLSMNGTYRVVIDGDP
NYGNGEATGNYSFRFLDKATAPVVNLDTDITGTLDNIIGSTAYRFNITGGSKYLYIDGQA
GTTNNQWIIYAPNGQNITSNIINSDREFWAGEGEYLLVMQGNGASDTNYKLRIITPELIT
SAITLGNTVSGSISEKGEQDTYTFTGTAGQQLFYDALGGDYFRLRFYDPTGREIYNADSR
SDRGTNDGLVLSMNGTYRVVIDGEPNYGNGEATGNYSFRFLDKAVATPVTFNTDISGTFD
AGLGSQLYRFNAQAGQHFYLDTATGQYPNSWIIYGTGGQYINSGYLQEGYSNNDYEFAAP
TTGEYLLVMQGNGAANTNYKFHLASPQFDYTNLSLGNLVIGNIATRGEQDIYAFTGTVGQ
QLFFDAIAGNPNLKARLYSPTNILVADRDTNSDWSPVNLIENGTYRFIIDGVGTTTGNYS
FIVSNRAAASTLTLGNTLTSSLTPDNQINLYKFNGKQGQILNFDLNAATWVGANWTFYDP
SGKAIKTPAANNPDFQATLAADGIYTLAIAGNSSTPVNYSFIVTDNSTTPVTNSGLGTLQ
TGNLNAGQVIDYNFTATAGTKVLFDSLDNNSNNWQIRARLIKPDGTYIFSDYDSRFDSEP
ILLEQTGNYKLQIFGYYGSTTGSYQFSLRELPNGIRPGVSYLELGGVVAGTLNNLEQKIY
AFNGTNGLRLMFNSMTGDNVNAVVYDPNGNIVSALNNLAWNYDSNPYTLTQTGWYNLVVR
NQQNATSNFSFQLLELDTAPEISFGLPNTFSLPSGQQSQFYKLQAKAGERLYFDVITSNA
LDTNYRWKLYGAGNNLLFDQYQGYNAEIIIPYTGEYSLLIQGGYSSNQLNGSFQVTRHST
TTRDIIIPGNGKSSGGGEGTLGLFNVKLAAKDPAGATAIQDYQIRVVPDPENGNPVIIST
PQTKFGLDQEVYRYQLKSVDPENDALFYRLVDAPLGASINGDTGELLWFPTSGVKNGDRV
TFKVEVSDRRGGFDRQNFEVQVYNALGRIQGAVFDDLNSNGIRDTKLFSGDDPIVVFAVD
ISGSTAAPFYGTGQYKNVKTVLDAQVQAVLTFMEAVIAQGLGNKLKIGLLPFTDTAVIQD
MDLTTPGTQPYTTALADKDNDGVADIKQILQTYFPNGSSKFTPTLEIIDTLLDNISGNPN
LIFMSDGYGALDATKAAQVTADIKARGGSVTAFAIGQYATIETLDKIDPNALQVLEFDEL
FDIFSGFDPRYATEPLKENISVYLDLNNNGQLDGGEPVQITQKDTGESTLGTTRYQFTFD
GLEPGTYVVRQVVPSGYVQTLPSGNTSWTDTVTTAGEKFIHLFGVGKVREPANEDPFFTT
NPPALTQIKAGETLLYRANAVDPNADPVTYSLVLAPKGVTVDARTGTVVWTPTKSQVDQF
YKELRENKARLDAIGRGNAAETTAKFNILLTANDGRGGKALQYVNVEVLPDNNAPIFTST
PPADAQPQVGKVFQYQATAIDPDGDAISFELVNAPTGVTISTTGLLNWTPVANQLGDASG
GLRLHTFQIKVKDHKGGESLQTIKATVINPQPNRLPVITSIPRISSRLGNPYFYEIIASD
PDGDPLTYTLTTKPEGMTLVDNLITWTPQPQQSGANHVTLRVSDRQGGFVEQVFTINVTH
QAANRPPAITSAPDLVTNLEKEYQYNLTGSDPDGDLLLWSLDQAPDGMVIDINSGALRWQ
PKSTQTGNFTVAVRLMDNYGADAVQEYTLKVTGINTPPQIISTPITKAAQNQDYTYQVVA
NDPENDALVYSLGAKPVGMAIDAKTGLIRWTPAANQIGLQQVEVFVRDTQGGMSQQTYSL
EVVAAAINHAPNITSSPIFLANVGGTESYQYQVLATDPNAGDTLTYQLLQAPTGMAVNTT
TGLITWANPVVGNYQVVVAAVDSGGLGVTQGYTLTAKINQLPVIGSTNPPANATVGATYR
YDIQAYDPDGGKLTYTLDAESQKRGITIDQLGRLRWTPQANQVGTYPVTVTLTDSAGGKV
TQNFNLTVALDTIAPKVIVNRSRNVINKGEVVSFQVIATDNVGIANLRLLINNTPVEIDS
KGLATFTATDAGVITAKAIAVDTSGNSAETTTTVAVADPTDTEAPVVSLDLSAIANFEIT
APTEIRGTVNDANLLYYALEVAPADGSAPFKEVFRGTQPVTNGVLGVLDPTLLLNDTYQV
RLVAYDTNNRGNGVVELLDVKGDLKLGNFQISFADLELSVSGIPITLTRTYDTLTSNHKD
DFGYGWRMEFRDADLRTSLPKDEFYEEYGIRGVGFKEGDQVYVTLPGGKRERFTFKLEAI
NSLVNAFLGRSGLYKPTFVADKGVTSTLSVQTQGVVLIRGEGDQIVPFSGGSAFRFYNPQ
DWGNYYTLTTKEGITYQINATTGDIDTITNRNGDKLTFSDGGILSSNGQQVTFGRDAQGR
IATVTDPMGKQIKYEYDAQGDLIKVTDRENHTTGFDYSDSQPHYLEEIIDSLGRTGLKNE
YDQNGRLTKVFNAVGDAVQLEYNPDNSIYTFKDVFGNPTTYEYDVRGNIITEVDALGGIT
KRTFDDNNNVLSETNPEGETRSYTYDSQGNKLSETDPLGNVTRYTYNANNDLLTTTDALG
NTTTNVYDQKGNLLSISGQANGKITISYDGAGLPTSLTTSEGTTTFEYDAKGNLTKEINS
LGHEITYTYDANGNRLTETRQLTTSNGVRTLVTKTEYDAKGKVIQVTDAEGGVIQTVYDA
VGNKIEDIDANGRVTKYVYDQRGLLIETIYPDATPNNNSDNPRTRKEYDEAGRVIAEIDE
LGRRTEFKYDKLGRLTFTIFPDATPADNSDNPRTEKRYDQAGRLIAEVDELGNATRYIYN
EAGQLIATILPDNTPNNDDDNPRILTSYDALGRQISQTDPLGHTTEFLYDQLGRPIGQIL
PDQTTTSAKFDDAGRIIARTDQAGNTTRYEYDAIGQLTAVIDALGQRTEYQYNELGNLSS
QKDANGNVTQYEYDGLGRRVSTTLPLGQLSTTQYDKVGNIISTNDFNGRKITFEFDERNR
LITKIFPDDTRVKYTYTLTGQRATETDTRGTTTYQYDTRDRLLSRTDPDGVKIAYTYDAA
GNRTAVTIPSGTTTYTFDAQNRLKTVLDPNNGETKYIYDLAGNIIRTELPNGTVEIREYD
SLNRLIFLKHTNANGVINSFRYTLNKVGDRIAVEEQDGRKVEYEYDKLYRFLKEDIFAPG
ATNPTRTISYTYDAVSNRQTRNDSQEGNTTYEYDQNDRLLKEVTNGVTTNYIYDNNGNTL
SKTTGTDKVTYEWDDENRLIGVDTNGDGIIDITNHYDSDGIRIVQTVNGEVTHFLVDKNR
DYAQVLEEYTPSKIIKVAYVYGNDLISQVRDDKHSFYHVDGLGSTRALTDINGLLTDSYD
YAAFGEIIQQVGNTKNLYLFAGEQFDNQLSQYYLRARYYDQSIGRFTQRDTWPGRDFSPI
TLHKYLYANANPANYIDPTGNFSIGSLLASMAIAGTINASLTFAFSGGNSTLRELGEAFG
IGAITAPIGGALTTLAGPLIRSMATPMLAAVGRMQPLTLVGSSGLEKALINMSRILVNTN
RSYPSVQSTFYGSLLKKMLPGVQWQQHHVFIQQAWSRSGGPNQIYNNLAANEGLRRIGNG
LWNLMPIPASLNGWLGRSPVATQLFATFYYSLVFFGPYHLWELINAAEESEADND
Download sequence
Identical sequences K9QZ75
WP_015140779.1.5551 gi|427731729|ref|YP_007077966.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]