SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427732164|ref|YP_007078401.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427732164|ref|YP_007078401.1|
Domain Number - Region: 27-135
Classification Level Classification E-value
Superfamily PhoU-like 0.0186
Family PhoU-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427732164|ref|YP_007078401.1|
Sequence length 147
Comment hypothetical protein Nos7524_5079 [Nostoc sp. PCC 7524]
Sequence
MLYLAQVHKNEFLDQYQLRLLARQEEDHLWTIIPEEAFILLGKGNTMSEKLLVLVELSST
GDIERMEDACDWVLYLVQTYLSTGVTPEFLQQEIERAEQWRQSLTLQNQDLARRSLELEA
RREQIQALEESLKRERNGYPKDINSGS
Download sequence
Identical sequences K9R0E5
WP_015141209.1.5551 gi|427732164|ref|YP_007078401.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]