SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427732181|ref|YP_007078418.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427732181|ref|YP_007078418.1|
Domain Number 1 Region: 39-203
Classification Level Classification E-value
Superfamily TPR-like 2.43e-38
Family Tetratricopeptide repeat (TPR) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427732181|ref|YP_007078418.1|
Sequence length 233
Comment hypothetical protein Nos7524_5096 [Nostoc sp. PCC 7524]
Sequence
MNRHSFLASGDQQNNCYQFVANTTFSEQGQGYHGDSYLRSCALQLAQQGNYTDAIALLSE
LINRHPHNAVDYNNRGLIYFQSGEMQKALRDYNAALKFNPHLASAYNNRANYYAACGELS
AALADYDRAIDFNPRHVRAWINRGITLRDLGQYEQAIENFDIVLLFGQLEGHIWAERGRT
YHLWGDWNCAIADYRRALTQLPSLDSKRDVLGDRLRLQIENWLDELLPSHLNW
Download sequence
Identical sequences K9R0A7
WP_015141226.1.5551 gi|427732181|ref|YP_007078418.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]