SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427729566|ref|YP_007075803.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427729566|ref|YP_007075803.1|
Domain Number 1 Region: 32-351
Classification Level Classification E-value
Superfamily Pectin lyase-like 7.53e-35
Family Filamentous hemagglutinin FhaB, secretion domain 0.0092
Further Details:      
 
Domain Number 2 Region: 442-543
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000104
Family Filamentous hemagglutinin FhaB, secretion domain 0.054
Further Details:      
 
Domain Number 3 Region: 370-464
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000242
Family Filamentous hemagglutinin FhaB, secretion domain 0.068
Further Details:      
 
Domain Number 4 Region: 549-637
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000267
Family Filamentous hemagglutinin FhaB, secretion domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427729566|ref|YP_007075803.1|
Sequence length 848
Comment filamentous hemagglutinin family domain-containing protein [Nostoc sp. PCC 7524]
Sequence
MSSFIFKIKSKLQFCIWISSLLFFFLDSKSTTAEIIPDTTLPINSTVRPSGSIRIIEGGT
QRGENLFHSFQDFSFSVLTRNRTGNTALFNHDLGVKNIITRVTGSLPSRIDGLIQTRPGS
TANLFLINPRGIIFGASAILDIGGSFIATTANSVKFADGIEFGVSNSETSPLLTVSVPVG
LQFGNNPGTITQPISDFIPLGLEVSEGKTLALIGGDVSLVNSFLAAPGGRIELGSVTNNS
FVSLTKIEQGYALGYADIGSFGDIQLTAGTIVDASDFPRLNRGGAIQIQGRNITLDDSLV
FSVTFGSSTGENLVINARESLRLNNSSNIATAAQGAGKAGDILITAQDTVQLGATSFISS
QVCPLGGNCETVTGNGGNVTVATRQVLLTDGGGIEVSTFGQGNTGNILVTARESINLIGE
TPDGNIPSGISAQVDQDAIDNPGNVGNITLETTNLTIQNGAQISNAARYSGKGGNITINA
ADNILISGASPFATTSPVDIYRSGIFVSAQPGATNNVGSLDINTQLLTVEDGGRITADNF
GAGETDIQQLNVGKLVIRDGGEIRTGAFGAGASGTLIVKARDGVEVTGSGRIAESNVASS
LSSRTEGDGKAGNLMIDSKSLLIADGGEVAVSSQGNGEVENLEVTARDVKLDQGKITASG
GANITFNLRGLLLLRNNSQILTRAGGKIAINSPFIVAFPQENSDITANGEGGKVTINTKG
IFGLVVRSREELEQLLGTTDFSQLDPQRLPTNDITAFSQPIPSLNGLFTINSPEVEPSQR
LVQLPTDIHLSQQMTISCNPASAVPNSHKIVEAQGWMVDAHGNIVLVAQKTTNHLHPWLP
SAACHVHK
Download sequence
Identical sequences K9QSR9
gi|427729566|ref|YP_007075803.1| WP_015138648.1.5551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]