SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427731120|ref|YP_007077357.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427731120|ref|YP_007077357.1|
Domain Number 1 Region: 26-339
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.45e-32
Family Filamentous hemagglutinin FhaB, secretion domain 0.012
Further Details:      
 
Domain Number 2 Region: 879-976
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000126
Family Filamentous hemagglutinin FhaB, secretion domain 0.054
Further Details:      
 
Domain Number 3 Region: 1046-1194
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000104
Family Filamentous hemagglutinin FhaB, secretion domain 0.07
Further Details:      
 
Domain Number 4 Region: 727-847
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000471
Family iota-carrageenase 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427731120|ref|YP_007077357.1|
Sequence length 1461
Comment filamentous hemagglutinin family domain-containing protein [Nostoc sp. PCC 7524]
Sequence
MSSKAMRLDWLQGLGIAIASVVALYANSSVAQITPDGTLPNNSSVTLEGNTINIQGGTTR
GANLFHSFQDFSVPTGFETLFNNSADIQNIIGRVTGSSISHIDGLIKANSTANLFLINPN
GFIFGENARLDIRGSFFATSANSMKFPDGSEFSATNPQAPPLLTVNVTPGLQYGASQVGA
MITNRGNLTPQQDLTLVADTLDLQGQLKAGRNITLIGNQAINLKTNLTLNPSNDDSIGKV
SLTTTSGDVTTKAITTNGGAIEINSAGAIKTQTLDTRNEANHGGAIALTANDSIKTGDLL
SYSYSVSQDTKQGGEITLVAKGGSITTGIVDSSSDSRSGNAKDGGRIVLSANDSIKTGDL
FSYSYSRVGSAGNGGAIDFQTNNSIHTGDLFSYSDSRVGSEGNGGAINFQANDSIKTGDL
FSYSYSRVGSAGNGGVITFTGLDNITTGDLLSYSYSQSGSAGNGGLIAINSNGEIYSGYL
DSSSESTAGTAGNGGSISLSARNNINTTGGLLSQSISRVGTKGNGGAINLISFNGSIDIG
TFTGIFFTGVLNSSSESTFGTAGNGGRINIEAAKDINITQTLDSGSESNRGIAGNGGVIN
VISWNGNINIGSFVEGNPLGGFFSTSRSVNGNQAGDGGAVSLAAKNGSVAILGASGSLSF
SNQGTAGDGGVISLEADSNIEILANLDSYSQSSLGKAGNGGLITINSFNGSITTGNLNSF
SYSDYGNAAQGGTISLQAKDRIDTGSIYSVGTLGSGNITIASNAPFIFGAYENGNPKGIA
SNTFGSGRGGDIQITAPAISLDNGAQISASTFSGGTGGNIHLNATNLIEVSGATSNQPSI
LFNVTRLSGIPAGSSPFGYIPTSINPPNPTADGTTFPSGVFTQATIGSTGNAGNLIIETG
RLIVKDGGAIATTTFGQGSNAGDISIKADSILVDNGSILSGVAGGARGDSGKIDLQARSL
DVTNGGIVQTQTLGQGKAGEITVNATKQVNISGAGSALRSSSGGDNNLLGNTGSTDIGSG
GNINLTTANLSVVDHAVVDATTQTNSQGGNITVNAEIFQTTTGGKLLTSTSGSGNAGDIA
VNVQEMQLGADSGLFAQTLSSAKAGNLTIQPLNNGQSLLVNLEDGAQISASTLSSGQGGT
LTVKAPESITITGNGSIISAETTGSGTGGDLTLETGKLTVRDGAQITVSSVGSGKAGALT
VDANSILLDNQGKIRADTRGGGGNIFLNSPLLLLRRGSSITTNASGNDITGGNINIDTKN
GFIVAVPQENSDIRADSENFRGGNVTIRNAAGIFGIQSRQEPSPNTSDMTAKGATPDLSG
NIEITPPDVDPSRGLVELPINLVDASRQIANACTPGTEQFQNTFVATGRGGLPMSPAEPL
QDASTLSAWVRFRPQPENSATTKITPPATAVSTTPKVAAATAIVEVAGWVVDGNGNVELV
AQVPALKPHSPWQTPASCPVS
Download sequence
Identical sequences K9QVX8
WP_015140179.1.5551 gi|427731120|ref|YP_007077357.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]