SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428216441|ref|YP_007100906.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428216441|ref|YP_007100906.1|
Domain Number 1 Region: 10-261,295-461
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.3e-26
Family Galacturonase 0.021
Further Details:      
 
Domain Number 2 Region: 548-678
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000000401
Family Serralysin-like metalloprotease, C-terminal domain 0.0014
Further Details:      
 
Weak hits

Sequence:  gi|428216441|ref|YP_007100906.1|
Domain Number - Region: 688-740
Classification Level Classification E-value
Superfamily beta-Roll 0.034
Family Serralysin-like metalloprotease, C-terminal domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428216441|ref|YP_007100906.1|
Sequence length 779
Comment hypothetical protein Pse7367_0161 [Pseudanabaena sp. PCC 7367]
Sequence
MAIINVDITTDENDGIGVGAGTSLREAIIEANTNVDAIDTINLVGGLTYNLTLSGANEEA
AAFGDLDILNNNNITIQALGGGNATIDASTLAAGDRIFDIVSSGVTLNLLNLDLTGGDVS
GDGGAIRISFSADATLNITDSNITGNTASSDGGGIQTYNNDFINISGTTISGNSAGTSGG
GLQAQDNNSVTIDDSVISNNNVGFSSGGGLFFDDNNTVTITDTTVSGNSAVEDGGGILFD
QNNIVSITSTTVSNNTISGGSIGSNGGGIFVGGGINSDIEISNSTISSNTADEDGGGIFF
AANASEGSPPINISNSTIALNLALAGGGVFIGAGDTNVQFDNTIVATNNAAEGSDIFDSG
ATVTSNGFNLIGDNTSVGATFPAGNPNGNNDIVGTNAVPIDPLLGPLQNNGGLTETHELL
AGSPAIDAGDPGFTAPPDFDQRGAGFDRIVNGIVDIGAFESGNNGGGEIDLSVIKTPAPG
ADLTPLPGAQITYNIEVANVGDANAENASISDIFPAELSGVEWSFTDSEGTPFEGNGDLN
VDGVVINGGDTVTITATGHVDCDLTDGTITNTANVSVVGDVEEANLANNTDTDSSFSLAA
NSPGVVNFGNSFFGTPNSDVIIGNANNNNINGNAGDDRLFGSAGIDRINGQAGNDLVVGG
SGNDFLNGGTGDDTLDGACTTLGVGQIDRLTGGGGDGMDTFILGNELGAFYVGNGNADFA
YLTDFATGMDTIQLAGALEDYTFMQTTVNNISGQGIFQGGDLVAILQQSSAAPGDFVFV
Download sequence
Identical sequences K9SE59
gi|428216441|ref|YP_007100906.1| WP_015163452.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]