SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428216697|ref|YP_007101162.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428216697|ref|YP_007101162.1|
Domain Number 1 Region: 57-199
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 6.93e-47
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0000204
Further Details:      
 
Domain Number 2 Region: 3-55
Classification Level Classification E-value
Superfamily UBA-like 2.81e-16
Family TS-N domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428216697|ref|YP_007101162.1|
Sequence length 203
Comment elongation factor Ts [Pseudanabaena sp. PCC 7367]
Sequence
MAEISAKQVKELRAKTGAGMKDCKVALTESEGDEKKATEWLRQKGLASAGKKAGRAASEG
IIHSYIHFGARIGVLVEVNCETDFVARREEIKELADNVAKQIAASANVKYVSVADIPQAY
IDQEKEIEAKKDDLAKKPDNIREKIVQGRIDKQLKELCLLDQPYIKDPSITIDELVKQTA
SKLSENVKVSRFARFVVGESDEE
Download sequence
Identical sequences K9SG28
gi|428216697|ref|YP_007101162.1| WP_015163708.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]